Recombinant Nitrosospira multiformis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your required tag type for preferential development.
Synonyms
plsY; Nmul_A2062; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Target Names
plsY
Target Protein Sequence
MTLIALILPAYLLGSISFGVLASRFFQLPDPRTYGSGNPGATNVLRSGKKSAAIFTLLGD GGKGWLAVALAEYSAPLLELGNEAVAAAALGVFLGHLFPVFLHFKGGKGVATALGILLGF NPWMGLLAATIWLAVALMWRFSSLAAIVAASLAPFYALFFLGFEARTLVVFIMSLLLIWR HKSNIAGLIAGSESRIGKRSTS
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Glycerol-3-phosphate acyltransferase (PlsY) in bacterial metabolism?

PlsY catalyzes the rate-limiting step in bacterial membrane phospholipid biosynthesis by transferring an acyl group from acylphosphate to glycerol-3-phosphate, resulting in the formation of lysophosphatidic acid (LPA). This reaction represents the first committed step in the glycerolipid biosynthesis pathway that ultimately leads to the production of phospholipids essential for bacterial membrane structure and function. In this process, PlsY works in conjunction with PlsX, which converts acyl-acyl carrier protein to acylphosphate that serves as the substrate for PlsY . The reaction catalyzed by PlsY is fundamental to bacterial membrane biogenesis and represents a crucial metabolic pathway that differs from the eukaryotic glycerolipid synthesis pathway, making it a potential target for antimicrobial development .

How does the membrane topology of PlsY influence its catalytic activity?

The membrane topology of PlsY significantly impacts its catalytic function as demonstrated by studies on Streptococcus pneumoniae PlsY. The enzyme possesses five membrane-spanning segments with the amino terminus and two short loops positioned on the external face of the membrane . The three larger cytoplasmic domains each contain highly conserved sequence motifs that are critical for catalysis. This arrangement places the active site on the cytoplasmic face of the membrane where it can access both the water-soluble glycerol-3-phosphate and the membrane-associated acylphosphate substrates . The proper orientation of these conserved motifs within the three-dimensional structure enables precise substrate binding and catalysis. Any disruption to this topology through mutations or inhibitor binding can significantly alter the enzyme's activity, underscoring the importance of maintaining the proper structural arrangement for catalytic function .

What are the conserved sequence motifs in PlsY and how do they contribute to enzyme function?

PlsY contains three highly conserved sequence motifs located in its cytoplasmic domains that are essential for catalytic activity:

  • Motif 1 contains an essential serine and arginine residue that are critical for catalysis. These residues likely participate in the acyl transfer reaction, possibly through nucleophilic attack or by stabilizing reaction intermediates .

  • Motif 2 displays characteristics of a phosphate-binding loop and appears to be responsible for glycerol-3-phosphate binding. Mutation studies have shown that converting the conserved glycines in this motif to alanines results in a defect in the Km for glycerol-3-phosphate binding, confirming this region as the glycerol-3-phosphate binding site .

  • Motif 3 includes a conserved histidine and asparagine that are important for activity, along with a glutamate that is critical for maintaining the structural integrity of the enzyme .

Each of these motifs plays a distinct role in substrate binding and catalysis, and their high conservation across bacterial species underscores their functional importance in the acyltransferase reaction mechanism .

What are the most effective methods for expressing and purifying recombinant Nitrosospira multiformis PlsY?

For successful expression and purification of recombinant Nitrosospira multiformis PlsY, researchers should consider the following methodological approach:

  • Expression System Selection: Use E. coli expression systems with vectors containing strong inducible promoters such as T7. Consider strains optimized for membrane protein expression like C41(DE3) or C43(DE3) to accommodate the five membrane-spanning segments of PlsY .

  • Construct Design: Include a fusion tag (His6, FLAG, or MBP) to facilitate purification, preferably at the C-terminus to avoid interfering with the membrane insertion of the N-terminus . For structural studies, consider incorporating a cleavable tag.

  • Solubilization Strategy: Since PlsY is an integral membrane protein, detergent solubilization is crucial. Screen various detergents including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin to identify optimal solubilization conditions that maintain enzyme activity .

  • Purification Protocol: Use a multi-step purification approach:

    • Initial capture via affinity chromatography (e.g., nickel affinity for His-tagged protein)

    • Secondary purification through ion exchange chromatography

    • Final polishing via size exclusion chromatography in the presence of appropriate detergent

  • Activity Verification: Assess the purified enzyme's activity using the acyltransferase assay with radiolabeled substrates similar to those described in research for other GPATs .

These methodological steps should yield functionally active recombinant PlsY suitable for further biochemical and structural characterization studies.

How can the enzymatic activity of recombinant PlsY be measured in vitro?

The enzymatic activity of recombinant PlsY can be measured using the following methodological approach:

  • Radiometric Assay: The most established method uses 14C-labeled glycerol-3-phosphate and monitors its incorporation into lysophosphatidic acid. The reaction mixture typically contains:

    • Purified recombinant PlsY enzyme

    • [14C]glycerol-3-phosphate (substrate)

    • Acylphosphate (generated by PlsX or synthetically prepared)

    • Appropriate buffer system (usually at pH 7.0-7.5)

    • Divalent cations (Mg2+ or Mn2+)

  • Reaction Conditions: Incubate the reaction mixture at 30-37°C for a defined period (typically 5-30 minutes). The reaction is terminated by adding chloroform:methanol mixture (2:1) to extract lipids .

  • Product Analysis: Separate the reaction products using thin-layer chromatography and quantify the radiolabeled lysophosphatidic acid using a scintillation counter . The specific activity is calculated as nmol of product formed per minute per mg of enzyme.

  • Kinetic Measurements: To determine kinetic parameters (Km, Vmax), vary the concentration of one substrate while keeping the other constant. Plot the data using Michaelis-Menten or Lineweaver-Burk analyses to determine kinetic constants .

  • Inhibition Studies: For inhibitor screening, include the test compound in the reaction mixture at various concentrations and calculate IC50 values based on percent inhibition compared to control reactions . For determining the mode of inhibition, perform kinetic analyses in the presence of fixed inhibitor concentrations.

This methodological framework provides quantitative assessment of PlsY activity and facilitates comparative studies of enzyme variants or inhibitor effectiveness .

What approaches can be used to identify potential inhibitors of Nitrosospira multiformis PlsY?

Several methodological approaches can be employed to identify potential inhibitors of Nitrosospira multiformis PlsY:

  • Structure-Based Design: Using the known membrane topology and conserved motifs of PlsY, design compounds that mimic the transition state or intermediate of the acyltransferase reaction. Focus on incorporating features that interact with the essential catalytic residues in Motif 1 (serine and arginine), the phosphate-binding loop in Motif 2, and the functionally important residues in Motif 3 (histidine and asparagine) .

  • Substrate Analog Development: Design and synthesize compounds that contain:

    • A negative charge at physiological pH to mimic the phosphate group of glycerol-3-phosphate

    • A long saturated chain to mimic palmitoyl-CoA

    • A sulfonamide linker to represent a stable mimic of the presumed transition state

  • High-Throughput Screening: Develop a miniaturized version of the radiometric acyltransferase assay for screening chemical libraries. Alternatively, adapt fluorescence-based assays using fluorescent-labeled substrates or products to enable higher throughput .

  • Evaluation Protocol: Test candidate compounds using:

    • Initial screening at fixed concentrations (e.g., 100 μM)

    • Determination of IC50 values for promising candidates

    • Assessment of selectivity against mammalian GPAT isoforms

    • Evaluation of antimicrobial activity against Nitrosospira multiformis

  • Structure-Activity Relationship Studies: Systematically modify the chemical structures of hit compounds to improve potency, selectivity, and physicochemical properties. For example, with benzoic acid derivatives, explore different positions of the sulfonamide group on the aromatic ring and vary the distance between the sulfonamide and carboxylate or phosphonate groups .

This comprehensive approach has been successful in identifying compounds with moderate GPAT inhibitory activity, such as 2-(nonylsulfonamido)benzoic acid, which could serve as starting points for developing more potent and selective PlsY inhibitors .

How does the substrate specificity of Nitrosospira multiformis PlsY compare to other bacterial acyltransferases?

The substrate specificity of Nitrosospira multiformis PlsY can be compared to other bacterial acyltransferases through several key characteristics:

  • Acyl Chain Preference: While specific data for Nitrosospira multiformis PlsY is limited, bacterial PlsY enzymes typically show preference for saturated long-chain acyl-CoAs, particularly palmitoyl-CoA (C16:0) . This preference differs from some eukaryotic GPATs that can accommodate a broader range of acyl chain lengths and degrees of saturation. Analysis of the acyl chain composition of membrane phospholipids in Nitrosospira multiformis would provide indirect evidence of its PlsY substrate preferences.

  • Nucleotide Preference: Unlike eukaryotic GPATs that predominantly use acyl-CoA as an acyl donor, bacterial PlsY utilizes acylphosphate generated by the companion enzyme PlsX . This represents a fundamental difference in substrate utilization between bacterial and eukaryotic acyltransferases and is likely conserved in Nitrosospira multiformis PlsY.

  • Stereochemical Selectivity: Bacterial PlsY enzymes typically acylate the sn-1 position of glycerol-3-phosphate, similar to most GPATs, but unlike some plant GPATs (such as GPAT4 and GPAT6 in Arabidopsis thaliana) that can acylate the sn-2 position . The stereochemical selectivity of Nitrosospira multiformis PlsY would likely follow this bacterial pattern.

  • Inhibition Profile: Bacterial PlsY enzymes, including that from Streptococcus pneumoniae, are noncompetitively inhibited by palmitoyl-CoA . This inhibition profile might be shared by Nitrosospira multiformis PlsY and could be experimentally verified using kinetic inhibition studies.

These comparative aspects of substrate specificity highlight the unique biochemical properties of bacterial PlsY enzymes and provide a framework for experimental characterization of Nitrosospira multiformis PlsY .

What role do the conserved active site residues play in the catalytic mechanism of PlsY?

The conserved active site residues in PlsY play specific and crucial roles in its catalytic mechanism:

  • Motif 1 Residues:

    • The essential serine residue likely functions as a nucleophile that may attack the carbonyl carbon of the acylphosphate substrate or stabilize reaction intermediates through hydrogen bonding .

    • The conserved arginine residue probably serves to stabilize the negative charge on the phosphate group during the transition state, facilitating the departure of the phosphate group from the acylphosphate substrate .

  • Motif 2 Residues:

    • This region forms a phosphate-binding loop with conserved glycine residues that create a flexible backbone structure essential for accommodating the phosphate group of glycerol-3-phosphate .

    • The spatial arrangement of these glycines allows for precise positioning of glycerol-3-phosphate, as evidenced by the observed Km defect for glycerol-3-phosphate binding when these glycines are mutated to alanines .

  • Motif 3 Residues:

    • The conserved histidine and asparagine residues likely participate in proton transfer steps or coordinate the acyl transfer reaction through hydrogen bonding networks .

    • The critical glutamate residue appears to play a structural role rather than a direct catalytic function, maintaining the proper three-dimensional architecture of the active site .

Together, these residues create a coordinated catalytic machinery that facilitates the acyl transfer from acylphosphate to glycerol-3-phosphate. The proposed mechanism involves:

  • Binding of both substrates in a specifically oriented manner

  • Nucleophilic attack by the primary hydroxyl group of glycerol-3-phosphate on the carbonyl carbon of acylphosphate

  • Formation of a tetrahedral intermediate stabilized by the conserved arginine

  • Collapse of the intermediate with release of phosphate and formation of the acyl-glycerol-3-phosphate product

The high conservation of these residues across bacterial species underscores their critical importance in the catalytic mechanism of PlsY enzymes .

What are the key differences between bacterial PlsY and eukaryotic GPAT enzymes in terms of structure and catalytic mechanism?

Bacterial PlsY and eukaryotic GPAT enzymes exhibit several significant differences in their structure and catalytic mechanisms:

These structural and mechanistic differences between bacterial PlsY and eukaryotic GPATs provide opportunities for developing selective inhibitors that target bacterial membrane phospholipid biosynthesis without affecting host enzymes .

How can site-directed mutagenesis of Nitrosospira multiformis PlsY inform structure-function relationships?

Site-directed mutagenesis of Nitrosospira multiformis PlsY represents a powerful approach to elucidate structure-function relationships through the following methodological framework:

  • Targeted Mutation Design Based on Conserved Motifs:

    • Motif 1: Generate serine and arginine mutations (to alanine or other amino acids) to assess their roles in catalysis. These residues are likely essential for the acyltransferase mechanism, and their mutation should significantly impair enzyme activity .

    • Motif 2: Create glycine-to-alanine mutations in the phosphate-binding loop to examine effects on glycerol-3-phosphate binding. Previous studies with other PlsY enzymes indicate these mutations result in increased Km values for glycerol-3-phosphate, confirming this region's role in substrate binding .

    • Motif 3: Develop histidine, asparagine, and glutamate mutations to investigate their contributions to catalysis and structural integrity. The conserved glutamate appears particularly critical for maintaining proper enzyme structure .

  • Methodological Approach for Functional Analysis:

    • Express wild-type and mutant enzymes under identical conditions

    • Purify to homogeneity using affinity chromatography

    • Verify proper folding through circular dichroism or limited proteolysis

    • Conduct detailed kinetic analyses to determine Km and kcat values for both substrates

    • Compare substrate binding affinities using isothermal titration calorimetry or surface plasmon resonance

  • Data Analysis Framework:

    • Construct a kinetic parameter table comparing wild-type and mutant enzymes:

Enzyme Variantkcat (s⁻¹)Km G3P (μM)Km Acylphosphate (μM)kcat/Km G3P (M⁻¹s⁻¹)Fold Change
Wild-type(value)(value)(value)(value)1.0
S-to-A (Motif 1)(value)(value)(value)(value)(ratio)
R-to-A (Motif 1)(value)(value)(value)(value)(ratio)
G-to-A (Motif 2)(value)(value)(value)(value)(ratio)
H-to-A (Motif 3)(value)(value)(value)(value)(ratio)
  • Integration with Computational Modeling:

    • Develop homology models based on related bacterial PlsY structures

    • Perform molecular dynamics simulations to analyze how mutations affect active site geometry

    • Use docking studies to predict changes in substrate binding interactions

This comprehensive mutagenesis approach would provide detailed insights into the catalytic mechanism and substrate specificity determinants of Nitrosospira multiformis PlsY, informing both fundamental understanding and inhibitor design strategies .

What are the implications of PlsY inhibition for antimicrobial development against Nitrosospira species?

The inhibition of PlsY in Nitrosospira species has several significant implications for antimicrobial development:

These considerations highlight the potential of PlsY as a promising antimicrobial target and provide a framework for the rational development of inhibitors against Nitrosospira multiformis PlsY .

How can cryo-electron microscopy contribute to understanding the structural dynamics of PlsY during catalysis?

Cryo-electron microscopy (cryo-EM) offers several powerful approaches to elucidate the structural dynamics of PlsY during catalysis:

  • High-Resolution Structure Determination:

    • Single-particle cryo-EM can potentially resolve the three-dimensional structure of PlsY at near-atomic resolution (2-4 Å), revealing the detailed arrangement of the five transmembrane segments and the three cytoplasmic domains containing the conserved catalytic motifs .

    • Sample preparation should include reconstitution of purified PlsY into nanodiscs or lipid nanodiscs to maintain the native-like membrane environment essential for proper folding and function of this integral membrane protein.

    • Data collection using direct electron detectors and image processing with motion correction and contrast transfer function estimation would optimize structural resolution.

  • Capturing Catalytic Intermediates:

    • Time-resolved cryo-EM approaches can potentially trap PlsY in different conformational states during catalysis by using substrate analogs, transition state mimics, or rapid mixing followed by vitrification.

    • These experiments could reveal how substrate binding induces conformational changes in the enzyme, particularly in the three conserved motifs that are critical for catalysis .

    • The visualized conformational changes would provide insights into how the essential serine and arginine residues in Motif 1, the phosphate-binding loop in Motif 2, and the functionally important residues in Motif 3 coordinate to facilitate acyl transfer .

  • Substrate Binding Analysis:

    • Cryo-EM structures of PlsY in complex with substrates (glycerol-3-phosphate and acylphosphate) or inhibitors would map the binding interactions and reveal how the conserved motifs participate in substrate recognition and catalysis.

    • Comparison of apo and substrate-bound structures would highlight the induced conformational changes and help elucidate the catalytic mechanism.

  • Integration with Computational Methods:

    • Cryo-EM structures can serve as starting points for molecular dynamics simulations to explore the dynamics of substrate binding, catalysis, and product release.

    • These computational analyses could reveal transient interactions and conformational states that might be difficult to capture experimentally.

This multi-faceted cryo-EM approach would significantly advance our understanding of PlsY structure and dynamics, potentially revealing novel aspects of membrane protein catalysis and providing crucial information for structure-based inhibitor design targeting bacterial membrane phospholipid biosynthesis .

What are common challenges in the expression and purification of recombinant PlsY and how can they be addressed?

Researchers working with recombinant PlsY commonly encounter several challenges during expression and purification, each requiring specific troubleshooting approaches:

  • Low Expression Levels:

    • Challenge: As an integral membrane protein with five transmembrane segments, PlsY often expresses poorly in conventional systems .

    • Solutions:

      • Optimize codon usage for the expression host

      • Use specialized expression strains (C41/C43) designed for membrane proteins

      • Test different fusion tags (His, MBP, SUMO) to enhance solubility

      • Explore lower induction temperatures (16-25°C) to allow proper folding

      • Consider cell-free expression systems for difficult-to-express variants

  • Protein Aggregation:

    • Challenge: Improper folding leading to inclusion body formation

    • Solutions:

      • Reduce expression rate by lowering inducer concentration

      • Add stabilizing agents such as glycerol (5-10%) or specific lipids

      • Include mild detergents during cell lysis

      • Explore refolding protocols if inclusion bodies form

      • Test expression as a fusion with solubility-enhancing partners

  • Detergent Selection Issues:

    • Challenge: Finding detergents that efficiently extract PlsY while maintaining its activity

    • Solutions:

      • Screen multiple detergent classes (maltoside, glucoside, fos-choline)

      • Test detergent mixtures for synergistic extraction

      • Consider the use of calixarene-based detergents for stabilization

      • Measure enzyme activity in each detergent to ensure functional extraction

  • Purification Interference:

    • Challenge: Contaminating proteins or lipids co-purifying with PlsY

    • Solutions:

      • Implement multi-step purification strategy (affinity → ion exchange → size exclusion)

      • Include high-salt washes to reduce non-specific binding

      • Use mild detergent exchange during purification

      • Consider on-column detergent exchange procedures

  • Activity Loss During Purification:

    • Challenge: Reduced enzyme activity after purification

    • Solutions:

      • Add stabilizing lipids (phosphatidylglycerol) during purification

      • Include reducing agents to prevent oxidation of cysteine residues

      • Minimize temperature fluctuations during purification

      • Test reconstitution into liposomes or nanodiscs for activity recovery

By systematically addressing these challenges, researchers can significantly improve the yield and quality of recombinant PlsY preparations, enabling more reliable structural and functional studies of this important bacterial acyltransferase .

How should researchers analyze and interpret kinetic data from PlsY activity assays?

Proper analysis and interpretation of kinetic data from PlsY activity assays require a systematic methodological approach:

  • Initial Velocity Determinations:

    • Ensure reactions are measured in the linear range of product formation over time (typically first 5-15% of substrate conversion)

    • Plot product formation versus time to confirm linearity

    • Calculate initial velocities from the linear portion of these plots

    • Include appropriate enzyme-free and heat-inactivated enzyme controls

  • Michaelis-Menten Kinetics Analysis:

    • Determine Km and Vmax parameters by varying one substrate concentration while keeping the other fixed at saturating levels

    • Use the following analytical approaches:

      • Non-linear regression fitting to the Michaelis-Menten equation: v = Vmax[S]/(Km + [S])

      • Linear transformations such as Lineweaver-Burk (1/v vs. 1/[S]), Eadie-Hofstee (v vs. v/[S]), or Hanes-Woolf ([S]/v vs. [S])

    • Calculate catalytic efficiency (kcat/Km) to assess the enzyme's performance under physiological conditions

  • Bisubstrate Kinetic Analysis:

    • As PlsY catalyzes a bisubstrate reaction (acylphosphate + glycerol-3-phosphate), determine the reaction mechanism by varying both substrates systematically

    • Analyze data using appropriate bisubstrate kinetic models:

      • Ordered sequential mechanism

      • Random sequential mechanism

      • Ping-pong mechanism

    • Create secondary plots (slopes or intercepts from primary Lineweaver-Burk plots) to distinguish between mechanisms

  • Inhibition Studies Interpretation:

    • For potential inhibitors, determine IC50 values by plotting percent inhibition versus inhibitor concentration

    • Characterize inhibition mechanisms through Lineweaver-Burk analysis at various inhibitor concentrations:

      • Parallel lines indicate uncompetitive inhibition

      • Lines intersecting on the y-axis indicate competitive inhibition

      • Lines intersecting to the left of the y-axis but above the x-axis indicate mixed inhibition

      • Calculate Ki values from these plots to quantify inhibitor potency

    • Note that palmitoyl-CoA exhibits noncompetitive inhibition of PlsY, which should be considered when analyzing inhibitor data

  • Data Representation and Statistical Analysis:

    • Present kinetic parameters in a comprehensive table format:

Substrate/InhibitorKm (μM)Vmax (nmol/min/mg)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)Ki (μM)
Glycerol-3-phosphate(value)(value)(value)(value)-
Acylphosphate(value)(value)(value)(value)-
Inhibitor A----(value)
  • Include statistical measures (standard error, confidence intervals) for all parameters

  • Report goodness-of-fit metrics (R²) for regression analyses

This methodical approach to kinetic data analysis provides reliable insights into PlsY catalytic mechanism and inhibitor interactions, essential for structure-function studies and inhibitor development .

What considerations are important when comparing PlsY activity across different bacterial species?

When comparing PlsY activity across different bacterial species, researchers should consider several important methodological and analytical factors:

  • Experimental Standardization:

    • Expression Systems: Use identical expression systems and conditions for all PlsY orthologs to minimize variation introduced by expression protocols.

    • Purification Methods: Employ consistent purification procedures, detergent compositions, and buffer systems to ensure comparable protein quality.

    • Activity Assays: Standardize assay conditions including temperature, pH, ionic strength, and substrate concentrations to enable direct comparisons .

  • Sequence-Structure-Function Relationships:

    • Perform multiple sequence alignments to identify conserved and divergent residues, especially within the three catalytic motifs that are critical for PlsY function .

    • Generate homology models to predict structural variations that might influence activity.

    • Consider phylogenetic relationships when interpreting activity differences between species.

  • Substrate Specificity Analysis:

    • Compare kinetic parameters (Km, kcat, kcat/Km) for both glycerol-3-phosphate and acylphosphate across different PlsY orthologs.

    • Analyze acyl chain length preferences by testing various acylphosphate substrates (C12-C18).

    • Assess the degree of substrate promiscuity, which may reflect evolutionary adaptations to different membrane compositions .

  • Environmental Context:

    • Consider the native growth conditions of each bacterial species (temperature, pH, osmolarity) when interpreting activity differences.

    • For extremophiles or specialized bacteria like Nitrosospira multiformis, adapt assay conditions to reflect their natural environment.

    • Examine the lipid composition of each species' membranes, as this may correlate with PlsY substrate preferences and activity profiles .

  • Inhibition Profile Comparison:

    • Test a panel of inhibitors across different PlsY orthologs to generate comparative inhibition data.

    • Create an inhibition sensitivity table to visualize species-specific responses:

InhibitorIC50 (μM) S. pneumoniae PlsYIC50 (μM) N. multiformis PlsYIC50 (μM) E. coli PlsYSelectivity Index*
Compound A(value)(value)(value)(value)
Compound B(value)(value)(value)(value)

*Selectivity Index = IC50 least sensitive species / IC50 most sensitive species

This comprehensive comparative approach allows researchers to identify species-specific characteristics of PlsY enzymes, evolutionarily conserved features essential for function, and potential species-selective inhibitors, contributing to both fundamental understanding and applied antimicrobial development .

What emerging technologies could advance structural studies of membrane-bound glycerol-3-phosphate acyltransferases?

Several cutting-edge technologies show promise for advancing structural studies of membrane-bound glycerol-3-phosphate acyltransferases like PlsY:

  • Advanced Cryo-EM Methodologies:

    • Microcrystal electron diffraction (MicroED) could enable structural determination of PlsY crystals too small for traditional X-ray crystallography.

    • Time-resolved cryo-EM with millisecond freezing capabilities could capture transient conformational states during the catalytic cycle.

    • Cryo-electron tomography combined with subtomogram averaging might reveal PlsY structure in its native membrane environment, potentially showing interactions with other membrane biosynthesis components .

  • Innovative Membrane Mimetic Systems:

    • Lipid cubic phase crystallization methods adapted for electron microscopy could provide better crystallization conditions for membrane proteins like PlsY.

    • Advanced nanodisc technologies incorporating specific lipid compositions matching bacterial membranes might stabilize PlsY in more native-like conformations.

    • Cell-free expression systems coupled with spontaneous reconstitution into nanodiscs could streamline the production of properly folded PlsY for structural studies .

  • Integrative Structural Biology Approaches:

    • Combining cryo-EM data with mass spectrometry-based footprinting and crosslinking would provide complementary structural information about dynamic regions.

    • Hydrogen-deuterium exchange mass spectrometry could map conformational changes associated with substrate binding and catalysis.

    • Solid-state NMR of isotopically labeled PlsY reconstituted into membrane mimetics could provide residue-specific dynamic information complementary to static structures .

  • Computational Methods:

    • AlphaFold2 and RoseTTAFold, with appropriate modifications for membrane proteins, could generate improved structural models of PlsY.

    • Enhanced molecular dynamics simulations using specialized force fields for membrane proteins would allow modeling of substrate binding, conformational changes, and catalysis.

    • Machine learning approaches integrating experimental data from multiple sources could improve model accuracy for regions difficult to resolve experimentally .

  • Single-Molecule Techniques:

    • Single-molecule FRET studies with strategically placed fluorophores could track conformational changes during substrate binding and catalysis.

    • High-speed atomic force microscopy might capture conformational dynamics of PlsY in membrane bilayers at near-physiological conditions.

These emerging technologies, especially when used in combination, have the potential to overcome the traditional challenges associated with membrane protein structural studies, providing unprecedented insights into PlsY structure, dynamics, and mechanism .

How might genetic engineering of PlsY contribute to the development of bacterial strains with modified membrane properties?

Genetic engineering of PlsY offers several promising strategies for developing bacterial strains with customized membrane properties:

  • Altered Substrate Specificity Engineering:

    • Target the glycerol-3-phosphate binding site (Motif 2) through rational mutagenesis based on the known phosphate-binding loop structure to modify substrate preferences .

    • Engineer the acyl chain binding pocket to accept non-native acyl donors, potentially incorporating branched, cyclic, or functionalized fatty acids into bacterial membranes.

    • Create PlsY variants with relaxed substrate specificity to generate bacteria capable of producing membranes with novel phospholipid compositions, potentially enhancing tolerance to harsh environmental conditions or industrial processes .

  • Activity Modulation for Membrane Engineering:

    • Develop PlsY variants with enhanced catalytic efficiency (increased kcat/Km) to boost phospholipid biosynthesis, potentially increasing membrane production for biotechnology applications.

    • Create temperature-sensitive or inducible PlsY mutants for controlled membrane biosynthesis, allowing temporal regulation of membrane composition.

    • Engineer feedback-resistant variants that bypass normal regulatory mechanisms, potentially increasing membrane phospholipid content for enhanced production of membrane-derived materials .

  • Synthetic Biology Applications:

    • Replace native PlsY with engineered variants in bacterial chassis organisms to create strains with:

      • Enhanced solvent tolerance for biofuel production

      • Improved resistance to membrane-targeting antibiotics

      • Specialized membranes for bioremediation of hydrophobic pollutants

      • Optimized membranes for protein expression and secretion systems

    • Combine PlsY engineering with modifications to other phospholipid biosynthesis enzymes for more comprehensive membrane remodeling.

  • Biocontainment and Synthetic Auxotrophy:

    • Engineer PlsY to depend on synthetic or non-natural substrates, creating bacteria that require specialized feeding for survival, potentially enhancing biocontainment for genetically modified organisms.

    • Develop conditionally active PlsY variants that function only in specific environments, providing an additional layer of biological containment.

  • Experimental Implementation Strategy:

    • Use CRISPR-Cas9 genome editing to replace the native plsY gene with engineered variants

    • Employ directed evolution approaches to select for desired membrane properties

    • Monitor membrane composition changes using lipidomics analysis

    • Assess growth characteristics and stress tolerance of the engineered strains

These genetic engineering approaches to PlsY modification could contribute significantly to the development of bacterial strains with novel membrane properties for various biotechnological applications, including biofuel production, bioremediation, and sustainable chemical synthesis .

What potential exists for developing PlsY inhibitors as narrow-spectrum antimicrobials targeting specific bacterial pathogens?

The development of PlsY inhibitors as narrow-spectrum antimicrobials targeting specific bacterial pathogens holds significant promise through several strategic approaches:

  • Species-Specific Structural Differences:

    • While the three conserved motifs in PlsY are highly preserved across bacterial species, subtle differences exist in non-catalytic regions that could be exploited for selective inhibitor design .

    • Comparative sequence and structural analysis between PlsY enzymes from different bacterial species can identify unique pockets or surface features adjacent to the active site that might accommodate species-tailored inhibitor moieties.

    • Structure-based virtual screening using homology models of PlsY from specific pathogens could identify compounds with preferential binding to particular bacterial variants .

  • Synergistic Inhibitor Design Strategy:

    • Create dual-targeting inhibitors that simultaneously engage both PlsY and another species-specific target, enhancing selectivity through a combination approach.

    • Design prodrug inhibitors activated by enzymes unique to particular bacterial species, ensuring selective toxicity.

    • Develop adjuvant molecules that selectively enhance PlsY inhibitor uptake or retention in specific bacterial pathogens through interactions with species-specific membrane transporters or efflux pumps .

  • Methodological Approach for Selectivity Assessment:

    • Establish a comprehensive testing panel of PlsY enzymes from diverse bacterial species

    • Implement parallel testing of inhibitor candidates against multiple PlsY variants

    • Create a selectivity index matrix comparing inhibitory potency across species:

InhibitorIC50 (μM) Against PlsY From SpeciesMax Selectivity Ratio*
Target PathogenRelated SpeciesHuman MicrobiomeNon-target
Compound 1(value)(value)(value)(value)(value)
Compound 2(value)(value)(value)(value)(value)

*Max Selectivity Ratio = IC50 least sensitive species / IC50 target pathogen

  • Potential Applications and Benefits:

    • Development of narrow-spectrum antimicrobials targeting specific pathogens like multidrug-resistant Pseudomonas aeruginosa or Acinetobacter baumannii without disrupting beneficial microbiome bacteria.

    • Creation of selective inhibitors for agricultural pathogens that spare beneficial soil microorganisms.

    • Design of combination therapies using selective PlsY inhibitors alongside broader-spectrum antibiotics to enhance efficacy while reducing collateral damage to the microbiome.

  • Challenges and Considerations:

    • Ensuring sufficient selectivity while maintaining potency against the target pathogen

    • Addressing potential resistance development through inhibitor modification or efflux

    • Optimizing pharmacokinetic properties for in vivo efficacy, particularly membrane penetration in Gram-negative pathogens

This targeted approach to PlsY inhibitor development represents a promising direction for next-generation antimicrobials that could help address both the challenge of antimicrobial resistance and the need for microbiome-sparing treatment options .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.