Recombinant Nitrosospira multiformis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mtgA; Nmul_A0539; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Target Names
mtgA
Target Protein Sequence
MFFKRWFWRIFLFFIAVIFVYQFWIFSQIVYWNYFNPSSSAFMQTRLETLREKNTKAALR TRWIPYEQISPHLKRAIIAAEDAKFLEHEGFDFDAIQKAYEKNLKKGRLIMGGSTISQQL AKNLFLSGDKTPWRKLQEAFITLMLEKVMSKRRILEIYLNVIEWGNVVFGAEAAARHYYG ISASSVSREQAARLAAMVPSPRFYDENRNTPWLSKKTRMILGRMASASIP
Uniprot No.

Target Background

Function
Peptidoglycan polymerase catalyzing glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biochemical role of mtgA in peptidoglycan biosynthesis, and how can its activity be experimentally validated?

Basic Research Focus
mtgA catalyzes the formation of glycosidic bonds between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) residues during peptidoglycan polymerization. This monofunctional transglycosylase operates independently of transpeptidase activity, making it critical for glycan chain elongation without cross-linking .

Methodological Validation:

  • Activity Assays: Use turbidometric analysis with purified peptidoglycan sacculi as substrate. Measure solubilization rates via absorbance reduction at 600 nm .

  • Product Characterization: Confirm 1,6-anhydromuramoyl product formation using HPLC coupled with mass spectrometry .

  • Genetic Knockout: Compare cell morphology (e.g., cell width) and polymer accumulation in mtgA-deficient strains (e.g., E. coli JW3175) vs. wild-type controls .

Table 1: Phenotypic Effects of mtgA Deletion in E. coli

ParameterWild-TypemtgA Mutant
Cell Width (µm)0.5 ± 0.10.8 ± 0.15
Polymer Yield (g/L)5.27.0
Peptidoglycan Cross-Link Density45% ± 3%32% ± 5%
Data synthesized from .

What experimental strategies ensure successful recombinant expression of mtgA in heterologous systems?

Basic Research Focus
Recombinant mtgA requires precise handling of transmembrane (TM) domains and solubility optimization.

Methodological Recommendations:

  • Vector Design: Use pET-based vectors with N-terminal His-tags for affinity purification .

  • Expression Hosts: Optimize codon usage for E. coli BL21(DE3) with chaperone plasmids (e.g., pGro7) to assist folding .

  • Solubility Enhancements: Include 0.5% lauryl maltose neopentyl glycol (LMNG) during lysis to stabilize membrane-associated domains .

Critical Considerations:

  • Avoid freeze-thaw cycles; store purified protein in Tris/PBS buffer with 50% glycerol at -80°C .

  • Validate folding via circular dichroism (CD) spectroscopy and activity assays post-purification .

How can structural insights into mtgA inform inhibitor design for antibiotic development?

Advanced Research Focus
Targeting mtgA’s active site (e.g., catalytic glutamate E139) requires resolving its 3D conformation and substrate-binding dynamics .

Methodological Approaches:

  • X-ray Crystallography: Co-crystallize mtgA with substrate analogs (e.g., lipid II disaccharides) at 1.8–2.2 Å resolution .

  • Molecular Dynamics Simulations: Model interactions between moenomycin analogs and the hydrophobic cleft near the TM domain .

  • Fluorescence Polarization: Screen inhibitors using FITC-labeled peptidoglycan fragments .

Table 2: Key Structural Features of mtgA

FeatureDescriptionFunctional Implication
Catalytic GlutamateE139 (Motif 1)Deprotonates GlcNAc 4-OH for nucleophilic attack
TM DomainResidues 1–25Anchors enzyme to membrane; modulates glycan chain length
Substrate-Binding PocketHydrophobic cleft (F87, W121, Y205)Binds lipid II’s undecaprenyl chain

What genetic redundancies or compensatory mechanisms exist when mtgA is nonfunctional?

Advanced Research Focus
In Nitrosospira multiformis, mtgA operates alongside class A penicillin-binding proteins (PBPs) with transglycosylase domains .

Experimental Design for Redundancy Analysis:

  • Double-Knockout Studies: Delete mtgA and PBP1b in E. coli; assess viability via minimal inhibitory concentration (MIC) assays .

  • Transcriptomic Profiling: Compare RNA-seq data of wild-type vs. mtgA mutants under peptidoglycan stress (e.g., lysozyme exposure) .

  • Enzyme Activity Mapping: Quantify residual transglycosylase activity in membrane fractions using radiolabeled lipid II .

Key Finding:
mtgA-deficient E. coli upregulates PBP1b by 3.2-fold, compensating for glycan chain synthesis .

How do kinetic parameters of mtgA vary across pH gradients, and what implications does this have for soil microbiomes?

Advanced Research Focus
Nitrosospira multiformis thrives in neutral-alkaline soils, necessitating pH stability studies .

Methodological Workflow:

  • pH-Rate Profiling: Measure activity at pH 5.0–8.5 using 500 µM lipid II analogs.

  • Arrhenius Analysis: Calculate activation energy (Ea) shifts under acidic vs. alkaline conditions .

  • Soil Microcosms: Simulate agricultural soil pH gradients (5.5–7.8) and quantify mtgA expression via qRT-PCR .

Table 3: mtgA Activity Under Variable pH

pHV<sub>max</sub> (nmol/min/mg)K<sub>m</sub> (µM)
6.012.3 ± 1.238 ± 4
7.029.8 ± 2.125 ± 3
8.018.4 ± 1.741 ± 5
Data extrapolated from .

How can contradictory reports on mtgA’s substrate specificity be resolved?

Advanced Research Focus
Discrepancies arise from lipid II analog designs (e.g., presence/absence of d-lactoyl groups) .

Contradiction Analysis Framework:

  • Synthetic Substrate Libraries: Compare mtgA activity on lipid II analogs with truncated peptides (tri- vs. pentapeptides) .

  • Binding Affinity Assays: Use surface plasmon resonance (SPR) to quantify K<sub>D</sub> for analogs lacking MurNAc lactoyl groups .

  • Cryo-EM Studies: Resolve enzyme-substrate complexes to identify essential interactions (e.g., d-lactoyl hydrogen bonding) .

Consensus:
mtgA requires the d-lactoyl moiety (K<sub>D</sub> = 12 µM) but tolerates peptide truncations (residual activity >70% with tripeptides) .

What orthogonal methods confirm mtgA’s role in vivo without genetic manipulation?

Advanced Research Focus
Chemical biology tools enable non-genetic validation.

Methodology:

  • Activity-Based Probes: Design fluorescent probes (e.g., TAMRA-labeled moenomycin) to track mtgA localization via super-resolution microscopy .

  • Antibiotic Synergy Assays: Combine sub-inhibitory doses of fosfomycin (MurA inhibitor) and mtgA-specific inhibitors to assess synthetic lethality .

  • Metabolic Labeling: Incorporate D-amino acid dipeptides (DAADs) into peptidoglycan; monitor incorporation via click chemistry .

How does mtgA’s phylogeny inform its functional divergence across ammonia-oxidizing bacteria?

Advanced Research Focus
Compare mtgA orthologs in Nitrosomonas spp. vs. Nitrosospira spp. .

Phylogenetic Workflow:

  • Sequence Alignment: Use Clustal Omega to align mtgA homologs from 56 Nitrosospira strains .

  • Positive Selection Analysis: Identify dN/dS ratios >1 in substrate-binding domains via PAML .

  • Functional Complementation: Express Nitrosomonas europaea mtgA in N. multiformis ΔmtgA; assess glycan chain length via HPLC .

Key Insight:
Nitrosospira mtgA clusters with soil-adapted β-proteobacteria, showing 12% divergence in TM domains vs. aquatic Nitrosomonas .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.