Recombinant Nitrosospira multiformis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Nomenclature and Classification

  • Recommended Name: NADH-quinone oxidoreductase subunit A

  • Alternative Names: NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1

  • Gene Name: nuoA

  • Ordered Locus Name: Nmul_A1013

  • EC Number: 1.6.99.5

Source Organism

  • Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849)

Function and Role in Nitrosospira

Nitrospira are nitrite-oxidizing bacteria (NOB) crucial in the global nitrogen cycle, converting nitrite to nitrate . They are widespread, phylogenetically diverse, and physiologically versatile, driving nitrite oxidation in various ecosystems .

Nitrospira possess multiple copies of several respiratory chain complexes . Specifically, N. moscoviensis contains three distinct copies of complex I, two of complex III, two cytochrome bd oxidases, and four copies of a putative cytochrome bd-like oxidase . Complex I in Nitrospira may be involved in reverse electron transport from quinol to low-potential ferredoxin, providing reduced ferredoxin for CO₂ fixation in the rTCA cycle .

Protein Characteristics

  • Sequence Information: Full-length protein

  • Amino Acid (AA) Sequence: MNASATQATEIWPLVAYFFLVVMLVVGVMALSYIIGERHRSKATDEPFESGIVTVGLARFRLSAKFYLIAVFFVIFDVEAVFLFAWAVAFRELGWPGYIEAIIFISILGAALAYLWRLGALDWGPPRHSAGRFAKDSRSPNHAVVSK

  • Expression Region: 1-147

  • UniProt Accession Number: Q2YAA5

Complex I Isozymes in Bacteria

Complex I isozymes play a crucial role in bacterial electron transport chains . In Rhodobacter sphaeroides, a facultative alphaproteobacterium, complex I is vital in linking catabolism to energy conservation .

Expression and Regulation

Transcriptomic analyses of N. moscoviensis suggest functional differentiation of multiple copies of respiratory complexes I and III . The expression levels of canonical complex I indicate that NADH-quinone oxidoreductase 2, rather than NADH-quinone oxidoreductase 3, catalyzes NADH production under nitrite-oxidizing conditions .

Availability

Recombinant Nitrosospira multiformis NADH-quinone oxidoreductase subunit A (NuoA) is available for purchase .

  • Quantity: 50 µg (other quantities may be available upon request)

  • Storage Buffer: Tris-based buffer, 50% glycerol (optimized for the protein)

  • Storage: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Nmul_A1013; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Target Names
nuoA
Target Protein Sequence
MNASATQATEIWPLVAYFFLVVMLVVGVMALSYIIGERHRSKATDEPFESGIVTVGLARF RLSAKFYLIAVFFVIFDVEAVFLFAWAVAFRELGWPGYIEAIIFISILGAALAYLWRLGA LDWGPPRHSAGRFAKDSRSPNHAVVSK
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is the presumed immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitrosospira multiformis NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in bacterial respiration?

NADH-quinone oxidoreductase subunit A (nuoA) is a component of Complex I in the electron transport chain of Nitrosospira multiformis, an ammonia-oxidizing bacterium. As part of Complex I, nuoA contributes to the first step of the respiratory chain where NADH is oxidized and electrons are transferred to quinone, coupling this reaction to proton translocation across the membrane. This process generates proton motive force (PMF) that can be used for ATP synthesis . The nuoA subunit specifically forms part of the membrane domain of Complex I and likely contributes to proton translocation rather than directly participating in the electron transfer reaction itself .

How does Nitrosospira multiformis Complex I differ from homologous complexes in other bacterial species?

Complex I in Nitrosospira multiformis is part of a diverse group of bacterial NADH:quinone oxidoreductases that show more flexibility in their electron transport chains compared to mitochondrial counterparts . While the core function remains electron transfer from NADH to quinone, bacterial Complex I variants can exhibit different substrate preferences and regulatory mechanisms. For example, in contrast to Nitrosospira multiformis, Escherichia coli Complex I has been more extensively characterized and includes nuoH, which was previously thought to contain the ubiquinone binding site, though this has since been revised . Different bacterial species also show varying energy conservation efficiencies through their Complex I, with some capable of contributing as much as 40% of the PMF used for ATP synthesis, similar to mitochondrial systems .

What are the optimal expression and purification conditions for recombinant Nitrosospira multiformis nuoA protein?

For optimal expression of recombinant Nitrosospira multiformis nuoA, E. coli is the preferred heterologous host due to its established protocols for membrane protein expression . The protein is commonly expressed with an N-terminal His-tag to facilitate purification. When designing expression systems, researchers should consider:

  • Using low-copy number vectors with inducible promoters (e.g., T7) to control expression levels

  • Growing cultures at lower temperatures (16-25°C) after induction to minimize inclusion body formation

  • Supplementing growth media with additional iron sources to ensure proper iron-sulfur cluster formation in the complete Complex I

Purification typically involves membrane solubilization using mild detergents (DDM or LMNG), followed by immobilized metal affinity chromatography (IMAC) utilizing the His-tag. The purified protein should be maintained in buffer containing 6% trehalose at pH 8.0 to preserve stability . After purification, it's recommended to aliquot the protein and store at -20°C/-80°C with 5-50% glycerol to prevent repeated freeze-thaw cycles, which can damage protein integrity .

How can researchers design experimental studies to investigate nuoA function within the context of the entire Complex I?

When investigating nuoA function within the complete Complex I, researchers should employ a comprehensive experimental design approach that considers the following components:

  • Explanatory factors: These should include genetic variables (wild-type vs. mutant nuoA), environmental conditions (aerobic vs. anaerobic, different pH levels), and substrate availability (ammonia vs. urea as nitrogen sources) .

  • Response variables: Measure enzymatic activity (NADH oxidation rates), proton translocation efficiency, growth rates, and expression levels of other complex subunits to assess compensatory mechanisms .

  • Treatments: Design experiments with appropriate controls that include deletion mutants, complemented strains, and point mutations in conserved residues of nuoA .

  • Experimental units: Use both whole cells and membrane preparations as experimental units to compare in vivo and in vitro activity .

  • Randomization and blocking: Implement proper randomization techniques while blocking for batch effects of protein preparation or bacterial culture conditions .

An effective approach is to create knockout strains (ΔnuoA) and complement them with wild-type or mutated versions of the gene, as demonstrated in studies with other Complex I subunits like nuoG . This genetic approach, combined with biochemical assays measuring NADH:quinone oxidoreductase activity and proton pumping efficiency, can reveal the specific contribution of nuoA to Complex I function.

What analytical techniques are most effective for studying protein-protein interactions involving nuoA within the Complex I assembly?

To investigate protein-protein interactions involving nuoA within Complex I, researchers should employ multiple complementary techniques:

  • Crosslinking coupled with mass spectrometry: Zero-length or variable-length crosslinkers can be used to identify proximity relationships between nuoA and other subunits. Crosslinked products can be analyzed by mass spectrometry to identify interaction interfaces.

  • Blue native PAGE: This technique preserves native protein complexes and can assess whether mutations in nuoA affect assembly of the complete Complex I structure.

  • Co-immunoprecipitation: Using antibodies against nuoA or its affinity tag to pull down the protein along with its interacting partners, followed by identification via mass spectrometry or Western blotting.

  • FRET (Förster Resonance Energy Transfer): By tagging nuoA and potential interacting partners with appropriate fluorophores, researchers can detect direct interactions in vivo.

  • Bacterial two-hybrid assays: Modified for membrane proteins, these can screen for potential interactions between nuoA and other Complex I components.

How does nuoA contribute to substrate preference and nitrogen utilization in ammonia-oxidizing bacteria like Nitrosospira multiformis?

Nitrosospira multiformis belongs to the β-AOB (ammonia-oxidizing bacteria) group, which has been shown to have distinctive nitrogen substrate utilization patterns. Research indicates that β-AOB species like Nitrosospira multiformis preferentially use urea before consuming substantial amounts of free ammonia when grown on mixtures of equal amounts of ammonia- and urea-N . This preference pattern differs significantly from other ammonia oxidizers such as AOA (ammonia-oxidizing archaea) and comammox species, which deplete ammonia before hydrolyzing significant amounts of urea .

The specific contribution of nuoA to this substrate preference likely relates to its role in energy conservation during respiratory electron transport. As Complex I is essential for generating proton motive force during respiratory growth, its efficiency directly affects energy availability for ammonia oxidation processes. Genomic analysis suggests that genes involved in the repression of ammonia uptake (glnB and glnD) are universally present in Nitrosospira genomes, which may explain their preference for urea . By maintaining efficient electron transfer through Complex I (including properly functioning nuoA), Nitrosospira multiformis can optimize energy conservation while utilizing preferred nitrogen sources.

What are the differences in electron transport chain functioning between Nitrosospira multiformis and other ammonia-oxidizing bacteria regarding Complex I utilization?

Electron transport chains in ammonia-oxidizing bacteria (AOB) exhibit significant diversity in their organization and efficiency. In Nitrosospira multiformis (β-AOB), Complex I plays a crucial role in energy conservation, but with distinctive characteristics compared to other bacterial groups:

These differences suggest that nuoA and other Complex I components in Nitrosospira multiformis have evolved specific adaptations that optimize function within the unique metabolic context of this ammonia-oxidizing bacterium.

What are common challenges in expressing and purifying functional recombinant Nitrosospira multiformis nuoA protein, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Nitrosospira multiformis nuoA:

ChallengePotential Solutions
Poor expression levels- Use codon-optimized gene sequences for E. coli
- Test different E. coli strains (C41/C43 designed for membrane proteins)
- Optimize induction conditions (temperature, IPTG concentration, induction time)
Inclusion body formation- Lower expression temperature to 16-20°C
- Reduce inducer concentration
- Use fusion partners that enhance solubility
Protein instability- Include stabilizing agents in buffers (e.g., trehalose at 6% as recommended)
- Maintain pH at 8.0 which has been determined optimal for this protein
Low purification yield- Optimize detergent choice and concentration for membrane solubilization
- Test different IMAC resins and elution conditions
- Consider purifying as part of a larger complex rather than individual subunit
Loss of activity- Ensure proper reconstitution in deionized sterile water to 0.1-1.0 mg/mL
- Add 5-50% glycerol for long-term storage
- Avoid repeated freeze-thaw cycles

Additionally, when attempting to express the entire Complex I or multiple subunits simultaneously, coordinate expression levels to match the stoichiometry of the native complex. This may require using multiple plasmids with different copy numbers or promoter strengths.

How can researchers differentiate between functional impairment of nuoA and other components in Complex I when analyzing experimental data?

Differentiating between functional impairment specific to nuoA versus other Complex I components requires a systematic approach:

  • Genetic complementation studies: Create a nuoA deletion strain and complement with wild-type or mutant versions of the gene. If wild-type complementation restores function but mutant versions do not, this confirms the phenotype is specifically due to nuoA .

  • Subunit-specific antibodies: Develop antibodies against nuoA and other Complex I subunits to monitor protein levels and complex assembly via Western blotting and immunoprecipitation.

  • Isolation of subcomplexes: Biochemically isolate subcomplexes of Complex I (e.g., membrane arm vs. peripheral arm) to determine which portion retains function.

  • Activity assays with different substrates: Compare NADH dehydrogenase activity (involving peripheral arm) with proton pumping efficiency (requiring membrane arm including nuoA) to localize the functional defect.

  • Cross-species subunit swapping: Replace Nitrosospira multiformis nuoA with homologs from other species to identify conserved versus species-specific functions.

What statistical approaches are most appropriate for analyzing complex experimental data involving nuoA function and interactions?

When analyzing complex experimental data related to nuoA function and interactions, researchers should employ the following statistical approaches:

  • Analysis of Variance (ANOVA): For experimental designs with multiple factors (e.g., different mutations, growth conditions), ANOVA can identify statistically significant effects and interactions . Consider:

    • One-way ANOVA for single-factor experiments

    • Multi-way ANOVA for experiments with multiple factors

    • Repeated measures ANOVA for time-course experiments

  • Multiple comparison procedures: When comparing multiple strains or conditions, use corrections for multiple testing such as Tukey's HSD or Bonferroni to control false positive rates .

  • Regression analysis: For quantitative relationships (e.g., between nuoA expression level and Complex I activity), regression models can identify correlations and potential mechanistic relationships.

  • Power analysis: Determine appropriate sample sizes before experiments to ensure sufficient statistical power to detect biologically significant effects.

  • Non-parametric methods: For data that doesn't meet assumptions of normal distribution, consider Kruskal-Wallis or Mann-Whitney U tests as alternatives to parametric approaches.

Experimental design should incorporate randomization and blocking where appropriate to control for batch effects or other systematic variations . Ensure proper controls are included for each experimental condition, and report effect sizes alongside p-values to convey biological significance in addition to statistical significance.

What are promising areas for future research regarding nuoA and its role in bacterial bioenergetics?

Several promising research directions could expand our understanding of nuoA's role in bacterial bioenergetics:

  • Structural biology approaches: Determining high-resolution structures of Nitrosospira multiformis Complex I with focus on nuoA's arrangement in the membrane domain would provide insights into proton translocation mechanisms.

  • Synthetic biology applications: Engineering nuoA variants with altered proton pumping efficiency could lead to bacteria with enhanced bioenergetic capabilities for biotechnological applications.

  • Ecological significance: Investigating how nuoA variants contribute to the fitness of ammonia-oxidizing bacteria in different environmental niches, particularly in relation to nitrogen cycling in ecosystems.

  • Comparative genomics across ammonia oxidizers: Expanding the analysis of nuoA sequence conservation and variation across diverse ammonia-oxidizing bacteria could reveal evolutionary adaptations to different ecological niches .

  • Integration with systems biology: Developing computational models that incorporate nuoA function within whole-cell metabolic networks would predict how perturbations to Complex I affect global cellular energetics.

These research directions would benefit from integrating multiple experimental approaches, including genetic engineering, biochemical characterization, and in situ studies in relevant environmental contexts.

How might studying Nitrosospira multiformis nuoA contribute to understanding broader questions about bacterial adaptation and evolution?

Studying Nitrosospira multiformis nuoA offers unique insights into several broader questions about bacterial adaptation and evolution:

  • Metabolic specialization: Nitrosospira multiformis has evolved as a specialized ammonia oxidizer with distinctive nitrogen utilization patterns compared to other bacterial groups . Understanding how nuoA contributes to these specializations could reveal mechanisms of metabolic niche adaptation.

  • Energetic trade-offs: Complex I efficiency directly impacts the energy budget available for other cellular processes. Examining how nuoA structure relates to energy conservation efficiency could illuminate evolutionary trade-offs between growth rate, stress tolerance, and metabolic flexibility.

  • Horizontal gene transfer vs. vertical inheritance: Comparative genomic analysis of nuoA across bacterial lineages could reveal instances of horizontal gene transfer versus vertical inheritance, providing insights into the evolutionary history of respiratory complexes.

  • Environment-driven selection: Different environments may select for variants of nuoA with altered properties. Studying nuoA sequences from Nitrosospira multiformis isolates from diverse environments could reveal signatures of environment-driven selection.

  • Co-evolution with other complex subunits: The functional interdependence of Complex I subunits necessitates co-evolution. Analyzing evolutionary rates of nuoA compared to other subunits could identify constraints and coordinated evolutionary changes.

This research contributes to our fundamental understanding of how core bioenergetic machinery evolves while maintaining essential functions, with potential applications in synthetic biology and understanding microbial ecosystem functioning.

What technological innovations would advance research on nuoA and bacterial Complex I beyond current limitations?

Several technological innovations could significantly advance research on nuoA and bacterial Complex I:

  • Cryo-electron microscopy improvements: Enhanced resolution capabilities for membrane protein complexes would allow visualization of conformational changes during the catalytic cycle of Complex I, including the specific movements of nuoA.

  • Single-molecule techniques: Developing methods to study proton pumping at the single-molecule level would provide unprecedented insights into the mechanism and stoichiometry of proton translocation through the membrane domain containing nuoA.

  • In vivo activity probes: Novel fluorescent or electrochemical probes that can monitor Complex I activity in living cells would connect molecular-level understanding with physiological outcomes.

  • Microfluidic cultivation systems: High-throughput systems for cultivating and analyzing multiple bacterial strains with nuoA variants would accelerate comparative studies across conditions and genetic backgrounds.

  • Computational advances: Improved molecular dynamics simulations capable of modeling proton movement through membrane proteins would help predict how specific amino acid changes in nuoA affect proton translocation efficiency.

  • Synthetic biology tools for ammonia oxidizers: Development of better genetic tools specifically for ammonia-oxidizing bacteria would overcome current limitations in manipulating these environmentally important but experimentally challenging organisms.

These technological innovations would collectively enable researchers to bridge the gap between molecular-level understanding of nuoA function and ecological-level consequences for ammonia-oxidizing bacterial communities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.