Recombinant Nitrosospira multiformis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Commercial and research-grade recombinant nuoK is synthesized using Escherichia coli expression systems. Specifications from leading providers include:

Functional and Genomic Context

  • Operon Structure: The nuo operon (nuoA–nuoN) in N. multiformis is conserved across bacteria, encoding all 14 subunits of complex I .

  • Physiological Role:

    • Drives ATP synthesis via proton gradient generation during ammonia oxidation .

    • Essential for balancing redox states in lithoautotrophic metabolism .

  • Genomic Redundancy: N. multiformis possesses three nearly identical copies of key respiratory gene clusters (e.g., amo, hao), though nuo operon duplication is not explicitly reported .

Research Applications

  1. Enzyme Kinetics: Used to study electron transfer efficiency in β-proteobacterial ammonia oxidizers .

  2. Structural Biology: His-tagged recombinant nuoK aids in crystallography and membrane protein interaction assays .

  3. Metabolic Engineering: Insights from nuoK function inform bioenergy projects leveraging bacterial redox systems .

Evolutionary and Ecological Significance

  • Phylogenetic Distribution: Complex I subunits like nuoK are widespread in bacteria (52% of surveyed genomes) but rare in archaea .

  • Ecological Adaptation: In N. multiformis, nuoK supports survival in nitrogen-limited soils by coupling ammonia oxidation to energy conservation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development if feasible.
Synonyms
nuoK; Nmul_A1022; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Target Names
nuoK
Target Protein Sequence
MAAIPMHHGLLLAAILFALGMIGILVRRNLIFILMSIEIMLNAAGLAFVVAGSHWTQADG QVMFIFILSVAAAEVSVGLALLLLLHRRFQTLDADAVSKMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is considered the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase in Nitrosospira multiformis?

NADH-quinone oxidoreductase (complex I) serves as the entry point for electrons in the respiratory chain of Nitrosospira multiformis. This enzyme complex catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane, contributing to the establishment of a proton gradient used for ATP synthesis. In Nitrosospira multiformis, which functions as an ammonia-oxidizing bacterium, this enzyme plays a crucial role in energy conservation during the oxidation of ammonia to nitrite, supporting the organism's chemolithoautotrophic lifestyle .

What distinguishes Nitrosospira multiformis NADH-quinone oxidoreductase from similar complexes in other bacteria?

Unlike the cytoplasmic enzyme complexes found in bacteria such as Nitrobacter, Nitrococcus, and Nitrolancea, Nitrosospira multiformis contains a periplasmic enzyme complex similar to that found in Nitrospira, Nitrospina, and Nitrotoga species . The NADH-quinone oxidoreductase complex in Nitrosospira multiformis shows adaptations specific to ammonia-oxidizing metabolism, including modifications that allow efficient energy conservation at the relatively low potential difference between ammonia oxidation and oxygen reduction. Additionally, the complex contains subunit variations that may reflect adaptation to the soil environments where Nitrosospira multiformis typically resides .

What are the optimal conditions for expressing recombinant Nitrosospira multiformis nuoK in heterologous systems?

For optimal expression of recombinant Nitrosospira multiformis nuoK, consider these key parameters:

  • Expression System Selection: E. coli BL21(DE3) strains generally yield better results than K-12 derivatives for membrane proteins like nuoK.

  • Temperature Control: Lower expression temperatures (16-20°C) significantly improve proper folding and membrane insertion.

  • Induction Conditions: Use lower IPTG concentrations (0.1-0.3 mM) with extended expression times (16-24 hours).

  • Media Formulation: Terrific Broth supplemented with glucose (0.5%) helps minimize basal expression while providing nutrients for prolonged expression periods.

  • Membrane Fraction Enrichment: For downstream applications, thorough isolation of membrane fractions using sucrose gradient ultracentrifugation is essential to maintain protein integrity .

Careful monitoring of growth conditions is critical as overexpression of membrane proteins can lead to growth inhibition and formation of inclusion bodies, significantly reducing functional protein yield .

What are the recommended methods for purifying recombinant Nitrosospira multiformis nuoK?

Purification of recombinant Nitrosospira multiformis nuoK requires specialized approaches due to its hydrophobic nature as a membrane protein:

  • Membrane Solubilization: Initially solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration or lauryl maltose neopentyl glycol (LMNG) at 0.5%, maintaining 4°C throughout the process.

  • Affinity Chromatography: Utilize histidine-tagged constructs with Ni-NTA resin for initial capture, incorporating 0.05% detergent in all buffers to prevent protein aggregation.

  • Buffer Optimization: Employ 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5% glycerol, and 0.02% DDM in the purification buffers to maintain protein stability.

  • Size Exclusion Chromatography: As a final polishing step, use Superdex 200 to separate the properly folded protein from aggregates.

Purification StepBuffer CompositionCritical Parameters
Membrane Solubilization50 mM Tris-HCl pH 8.0, 300 mM NaCl, 1% DDM, 5% glycerol1-2 hours at 4°C with gentle rotation
Ni-NTA Binding50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDM, 5% glycerol, 20 mM imidazoleFlow rate of 0.5 ml/min
Ni-NTA Washing50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDM, 5% glycerol, 50 mM imidazoleMinimum 10 column volumes
Ni-NTA Elution50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDM, 5% glycerol, 250 mM imidazoleCollect 0.5 ml fractions
Size Exclusion50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.02% DDM, 5% glycerolFlow rate of 0.3 ml/min

Successful purification yields are typically 0.2-0.5 mg of pure protein per liter of bacterial culture when optimal conditions are maintained .

How can functional assays be designed to assess the activity of recombinant nuoK?

  • Reconstitution Experiments: Incorporate purified nuoK into liposomes together with other essential subunits of the NADH-quinone oxidoreductase complex. This allows measurement of proton pumping activity using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine).

  • Complementation Assays: Express recombinant nuoK in bacterial strains with nuoK deletion and assess restoration of NADH oxidase activity and proton translocation.

  • Membrane Potential Measurements: Use voltage-sensitive dyes such as DiSC3(5) to measure changes in membrane potential when recombinant nuoK is incorporated into artificial membrane systems or nuoK-deficient bacterial membranes.

  • Proton Translocation Assays: Monitor proton movement across the membrane using NADH as electron donor and oxygen as terminal electron acceptor, with measurements taken via pH electrodes or pH-sensitive fluorescent probes.

For accurate assessment, control experiments should include:

  • Assays with known inhibitors (rotenone, piericidin A)

  • Systems lacking the nuoK subunit

  • Variants with site-directed mutations at conserved residues

These assays should be performed under standardized conditions (pH 7.5, 30°C) to allow reliable comparison between different experimental setups and research reports .

How should contradictory results between expression levels and functional activity be interpreted?

When encountering contradictory results between expression levels and functional activity of recombinant Nitrosospira multiformis nuoK, consider the following analytical framework:

  • Examine Methodology Differences: First, assess both studies' methodological approaches. The discrepancy may arise from differences in expression conditions, purification methods, or activity assay protocols. For example, high expression levels combined with low activity may indicate improper protein folding or membrane insertion .

  • Participant Variables in Experimentation: Consider whether different bacterial strains or cell lines were used across studies. Strain-specific factors can significantly influence post-translational modifications and protein folding machinery .

  • Triangulation of Results: Apply a triangulation strategy using multiple assay methods to validate findings. Quantitative metrics (expression levels) and qualitative assessments (functional activity) often provide complementary rather than contradictory information when properly contextualized .

  • Consider Protein Interaction Requirements: NADH-quinone oxidoreductase requires multiple subunits functioning together. High expression of nuoK without corresponding expression of partner subunits may lead to non-functional protein despite abundant production .

  • Evaluate Post-Translational Factors: Investigate whether differences in post-translational modifications or membrane incorporation efficiency explain the observed discrepancies.

A systematic approach that acknowledges both the technical limitations of each methodology and the biological context will provide the most accurate interpretation of seemingly contradictory results .

What statistical approaches are appropriate for analyzing nuoK expression data from transcriptomic studies?

  • Normalization Protocols: Begin with proper normalization using methods such as:

    • TPM (Transcripts Per Million) for RNA-seq data

    • RPKM/FPKM (Reads/Fragments Per Kilobase Million)

    • Quantile normalization for microarray data

  • Differential Expression Analysis:

    • For parametric data: Apply DESeq2 or edgeR with false discovery rate (FDR) correction

    • For non-parametric approaches: Use NOISeq or SAMseq for datasets with unusual distributions

    • Implement at least two methods to validate consistency of results

  • Correlation Analysis:

    • Pearson correlation for normally distributed data

    • Spearman rank correlation when non-linear relationships are suspected

    • Apply to identify co-expressed genes that may function with nuoK

  • Multivariate Analysis:

    • Principal Component Analysis (PCA) to identify patterns in expression data

    • Hierarchical clustering to group experiments with similar expression profiles

    • WGCNA (Weighted Gene Co-expression Network Analysis) to identify modules of co-expressed genes

  • Experimental Validation Metrics:

    • Calculate statistical power based on observed effect sizes

    • Report confidence intervals alongside p-values

    • Implement multiple testing correction using Benjamini-Hochberg procedure

For time-series data, consider specialized approaches like EDGE or maSigPro that account for temporal expression patterns. Statistical significance should generally be set at p < 0.05 with FDR correction for multiple testing .

How can researchers distinguish between the effects of nuoK mutations and experimental artifacts?

Distinguishing genuine effects of nuoK mutations from experimental artifacts requires implementing a systematic validation framework:

  • Control Implementation Hierarchy:

    • Negative Controls: Include wild-type nuoK and empty vector transformants in all experiments

    • Positive Controls: Incorporate previously characterized mutations with known phenotypes

    • Technical Controls: Perform mock transformations and processing parallel to experimental samples

  • Reproducibility Assessment:

    • Biological Replicates: Minimum of three independent transformations

    • Technical Replicates: Minimum of three measurements per biological replicate

    • Cross-Laboratory Validation: When possible, validate critical findings in different laboratory settings

  • Multi-Method Confirmation:

    • Verify mutant phenotypes using orthogonal techniques (e.g., enzymatic assays, growth phenotypes, membrane potential measurements)

    • Compare in vitro and in vivo results to identify context-dependent effects

  • Dose-Response Relationships:

    • Test graded series of mutations (conservative to radical) to establish correlation between mutation severity and phenotypic effect

    • Implement conditional expression systems to modulate protein levels

  • Site-Directed Mutagenesis Strategy:

    • Create multiple mutations of the same residue (e.g., alanine scanning, conservative/non-conservative substitutions)

    • Design complementary mutations that should restore function if the hypothesis is correct

  • Statistical Analysis:

    • Apply ANOVA with post-hoc tests for multiple comparison experiments

    • Use trend analysis for dose-response experiments

    • Implement mixed-effects models when dealing with nested experimental designs

By implementing this comprehensive framework, researchers can confidently attribute observed effects to the nuoK mutations rather than experimental artifacts or statistical noise .

How can recombinant nuoK be utilized to study the ecological role of Nitrosospira multiformis in nitrification processes?

Recombinant nuoK provides a valuable tool for investigating the ecological significance of Nitrosospira multiformis in nitrification processes through several advanced applications:

  • Biomarker Development: Antibodies raised against recombinant nuoK can serve as specific biomarkers for tracking Nitrosospira multiformis populations in environmental samples, allowing correlation between its abundance and nitrification rates in soil and aquatic systems.

  • Structure-Function Analysis: By creating site-directed mutants of nuoK and testing their impact on energy conservation efficiency, researchers can understand how Nitrosospira multiformis has adapted its respiratory chain to function optimally in specific ecological niches where ammonia concentrations and oxygen availability may fluctuate.

  • Transcriptional Regulation Studies: Reporter gene constructs fused to the nuoK promoter region enable monitoring of gene expression responses to environmental stimuli such as ammonia concentration, pH, and oxygen availability, revealing how Nitrosospira multiformis regulates its energy metabolism under changing conditions .

  • Competitive Fitness Evaluation: Comparing wild-type and nuoK-modified strains in controlled microcosm experiments allows quantification of how energy metabolism efficiency influences the competitive success of Nitrosospira multiformis against other ammonia oxidizers in diverse environments.

  • Climate Change Impact Assessment: Studying how temperature affects the stability and activity of recombinant nuoK provides insights into how climate change might impact the functioning of Nitrosospira multiformis in soil ecosystems and consequently nitrogen cycling .

Through these applications, researchers can establish connections between molecular-level energy conservation mechanisms and ecosystem-level nitrification processes, revealing how the efficiency of electron transport in Nitrosospira multiformis influences global nitrogen cycling .

What approaches are effective for studying interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex?

Studying interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex requires sophisticated methodological approaches:

  • Protein-Protein Interaction Mapping:

    • Cross-linking Mass Spectrometry (XL-MS): Employs chemical cross-linkers to capture transient interactions between nuoK and neighboring subunits, followed by mass spectrometric analysis to identify cross-linked peptides, revealing the spatial relationships between protein components.

    • Co-immunoprecipitation with Tagged Subunits: Express nuoK with affinity tags alongside other complex subunits to pull down interaction partners, confirming associations through western blotting or mass spectrometry.

  • Structural Characterization:

    • Cryo-EM Analysis: For capturing the entire complex architecture at near-atomic resolution, revealing nuoK positioning relative to other subunits.

    • NMR Studies: Particularly useful for examining dynamic interactions between nuoK and adjacent membrane subunits.

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifies regions of nuoK that undergo conformational changes upon interaction with other subunits.

  • Functional Relationship Analysis:

    • Suppressor Mutation Screening: Identifying compensatory mutations in other subunits that restore function to nuoK mutants.

    • Site-Directed Mutagenesis at Interface Residues: Systematically mutating residues at predicted interface sites to assess their importance in complex assembly and function.

  • In silico Approaches:

    • Molecular Dynamics Simulations: Modeling dynamic interactions between nuoK and neighboring subunits in a membrane environment.

    • Evolutionary Coupling Analysis: Identifying co-evolving residues between nuoK and other subunits that likely represent interaction points.

MethodResolutionAdvantagesLimitations
XL-MSResidue-levelCaptures transient interactionsCross-linker accessibility dependent
Cryo-EM2.5-4Å for membrane complexesVisualizes entire complexRequires stable, homogeneous preparations
HDX-MSPeptide-levelDetects conformational changesIndirect measure of interactions
Co-IPProtein-levelConfirms physical associationMay detect indirect interactions
MD SimulationsAtomic-levelReveals dynamic behaviorsComputationally intensive, requires validation

These complementary approaches provide a comprehensive understanding of how nuoK functions within the larger complex, essential for elucidating the complete electron transport process in Nitrosospira multiformis .

How can computational modeling enhance our understanding of nuoK structure and function?

Computational modeling provides powerful insights into nuoK structure and function that complement experimental approaches:

Recent computational studies of homologous nuoK subunits have revealed conserved charged residues forming a discontinuous water channel essential for proton translocation, providing testable hypotheses for experimental validation in Nitrosospira multiformis .

What are common challenges in expressing recombinant nuoK and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant nuoK, which can be systematically addressed through targeted strategies:

  • Low Expression Yields:

    • Challenge: Membrane proteins like nuoK often express poorly in heterologous systems.

    • Solution: Test multiple expression systems including specialized E. coli strains (C41/C43, Lemo21), cell-free expression systems, or eukaryotic systems like Pichia pastoris. Optimize codon usage for the expression host and consider using fusion partners like MBP or SUMO to enhance solubility .

  • Protein Misfolding and Aggregation:

    • Challenge: Improper membrane insertion leading to inclusion body formation.

    • Solution: Lower expression temperature to 16-20°C, reduce inducer concentration, and use specialized growth media like Terrific Broth with 0.5% glucose. Addition of specific lipids or mild detergents during expression can also facilitate proper membrane insertion .

  • Toxicity to Expression Host:

    • Challenge: Expression of nuoK may disrupt host membrane integrity.

    • Solution: Use tightly regulated expression systems with minimal leaky expression. The pBAD system with arabinose induction offers fine-tuned control. Consider using bacterial strains with enhanced membrane protein expression capacity .

  • Proteolytic Degradation:

    • Challenge: Rapid degradation of expressed protein.

    • Solution: Include protease inhibitors during purification, keep samples at 4°C throughout, and consider co-expression with chaperones like GroEL/ES. C-terminal tags often experience less proteolysis than N-terminal tags for membrane proteins.

  • Inefficient Detergent Solubilization:

    • Challenge: Difficulty extracting nuoK from membranes without denaturation.

    • Solution: Screen multiple detergents including DDM, LMNG, and digitonin. Systematic testing of detergent:protein ratios is crucial, starting with 10:1 and adjusting as needed.

ChallengePrimary CauseRecommended SolutionExpected Outcome
Low YieldPoor transcription/translationOptimize codon usage, use T7-based systems2-5 fold increase in expression
AggregationRapid expression overwhelming insertion machineryReduce temperature to 16°C, use 0.1mM IPTGReduced inclusion bodies
ToxicityMembrane disruptionUse C41/C43 strains, tight regulationImproved cell viability
DegradationHost proteasesAdd protease inhibitor cocktail, keep at 4°CExtended protein half-life
Poor solubilizationInappropriate detergentScreen DDM, LMNG, digitonin mixturesImproved extraction efficiency

Implementation of these strategies has been shown to increase functional protein yields by 3-10 fold in similar membrane proteins .

How can researchers verify the structural integrity of purified recombinant nuoK?

Verifying the structural integrity of purified recombinant nuoK is essential to ensure that experimental results reflect the protein's native properties:

  • Biophysical Characterization Techniques:

    • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content. Alpha-helical membrane proteins like nuoK show characteristic minima at 208 and 222 nm. Compare spectra with predicted values based on homology models.

    • Thermal Stability Assays: Use differential scanning fluorimetry or CD with temperature ramping to determine melting temperatures, which indicate proper folding.

    • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Confirms monodispersity and determines accurate molecular weight in detergent micelles.

  • Functional Verification Methods:

    • Reconstitution Studies: Incorporate purified nuoK into liposomes and measure proton pumping activity.

    • Binding Assays: Verify interaction with known binding partners from the NADH-quinone oxidoreductase complex.

    • EPR Spectroscopy: For spin-labeled variants to assess tertiary structure and conformational dynamics.

  • Structural Analysis Approaches:

    • Limited Proteolysis: Properly folded proteins show distinct proteolytic patterns compared to misfolded variants.

    • Hydrogen-Deuterium Exchange Mass Spectrometry: Reveals solvent-accessible regions, providing insight into proper membrane topology.

    • Negative Stain Electron Microscopy: Confirms homogeneity and expected particle dimensions.

  • Membrane Insertion Verification:

    • Fluorescence Quenching Assays: Using environment-sensitive fluorophores to confirm proper membrane insertion.

    • Proteoliposome Flotation Assays: Demonstrate association with lipid bilayers.

    • Alkaline Extraction Resistance: Properly inserted membrane proteins resist extraction by sodium carbonate treatment.

Establishing minimum criteria for protein quality is essential before proceeding with experimental applications. At minimum, researchers should verify: (1) >90% purity by SDS-PAGE, (2) monodispersity by SEC, (3) expected alpha-helical content by CD, and (4) thermal stability with Tm >40°C in the chosen detergent system .

What strategies can improve reproducibility in nuoK functional studies?

Improving reproducibility in nuoK functional studies requires systematic implementation of quality control measures throughout the experimental workflow:

  • Standardized Expression and Purification Protocols:

    • Develop detailed standard operating procedures (SOPs) documenting every step of the process.

    • Implement batch-to-batch consistency checks including yield quantification, purity assessment, and activity measurements.

    • Maintain master cell banks of expression strains to minimize genetic drift.

    • Record and control for expression lot variability using reference standards.

  • Rigorous Quality Control Measures:

    • Verify protein identity through mass spectrometry or N-terminal sequencing for each preparation.

    • Assess protein stability and homogeneity through multiple methods (SEC, DLS, thermal shift assays).

    • Document detergent:protein ratios and lipid content in final preparations.

    • Implement acceptance criteria that preparations must meet before use in functional studies.

  • Controlled Experimental Conditions:

    • Precisely control temperature, pH, ionic strength, and redox conditions during functional assays.

    • Use internal standards and calibration curves for all quantitative measurements.

    • Minimize freeze-thaw cycles and document protein storage conditions.

    • Account for detergent or lipid effects by including appropriate controls.

  • Comprehensive Data Collection and Reporting:

    • Implement the minimum information about a protein functional assay (MIAPFA) guidelines.

    • Record raw data alongside processed results with clear documentation of analysis methods.

    • Maintain detailed electronic lab notebooks with searchable metadata.

    • Report both positive and negative results to minimize publication bias.

  • Validation Through Multiple Approaches:

    • Test functional properties using at least two independent assay methods.

    • Perform activity measurements under multiple conditions to ensure robustness.

    • Include wild-type controls and previously characterized mutants as benchmarks.

    • Validate critical findings through complementary techniques (e.g., confirm spectroscopic results with biochemical assays).

  • Statistical Rigor and Experimental Design:

    • Determine appropriate sample sizes through power analysis before beginning experiments.

    • Randomize sample processing order to minimize systematic errors.

    • Blind analysts to sample identity when possible during measurements and data analysis.

    • Apply appropriate statistical tests with correction for multiple comparisons.

Implementation of these comprehensive strategies has been shown to reduce inter-laboratory variability in functional measurements from >30% to <10% in similar membrane protein systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.