Recombinant Nitrosospira multiformis Probable intracellular septation protein A (Nmul_A2111)

Shipped with Ice Packs
In Stock

Description

Protein Overview

The recombinant Nmul_A2111 protein (UniProt ID: Q2Y767) is derived from Nitrosospira multiformis, a chemolithoautotrophic soil bacterium critical to global nitrogen cycling . Key specifications include:

PropertyDetails
Host organismEscherichia coli
TagN-terminal His-tag
Molecular length181 amino acids (Full-length)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C
Reconstitution guidelines0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability

The amino acid sequence is:
MKFLFDLFPVILFFITFKIYGIYAATAVAIGATFAQIGWVWFRHGKVDTMLWVSLVLIVVFGSATLILQDETFIKWKPSVLYWLFAAALLIAQAIFKKNFIRTMMKEQLTLPEPVWARVNASWAAFFAFMGAANLYVAFNYSTETWVNFKLFGFMGLMLVFVVLQGLMLSKYMATDEDKEA .

Research Applications

This recombinant protein is commercially available for:

  • Antibody development: Used as an antigen in ELISA kits (e.g., Creative BioMart’s $1,526 ELISA reagent) .

  • Structural studies: His-tag facilitates purification for crystallography or NMR.

  • Functional assays: Potential use in bacterial cell division or stress response studies, given its homology to E. coli YciB .

Limitations and Future Directions

  • Uncharacterized pathways: While Nmul_A2111 is implicated in septation, its specific interactions and regulatory mechanisms remain undefined .

  • Ecological relevance: N. multiformis’s role in soil nitrification warrants further study of how septation proteins influence ammonia-oxidation efficiency under environmental stressors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
During production, we will determine the tag type. If you have specific tag requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
yciB; Nmul_A2111; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Target Names
Nmul_A2111
Target Protein Sequence
MKFLFDLFPVILFFITFKIYGIYAATAVAIGATFAQIGWVWFRHGKVDTMLWVSLVLIVV FGSATLILQDETFIKWKPSVLYWLFAAALLIAQAIFKKNFIRTMMKEQLTLPEPVWARVN ASWAAFFAFMGAANLYVAFNYSTETWVNFKLFGFMGLMLVFVVLQGLMLSKYMATDEDKE A
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining the integrity of the cell envelope and regulating membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nitrosospira multiformis Probable intracellular septation protein A (Nmul_A2111)?

Nmul_A2111 is a protein encoded by the Nitrosospira multiformis genome (strain ATCC 25196 / NCIMB 11849). It is classified as a probable intracellular septation protein A with a full length of 181 amino acids . The protein is part of the complete genome of N. multiformis, which consists of a circular chromosome and three small plasmids totaling 3,234,309 bp encoding 2,827 putative proteins . As an intracellular septation protein, it likely plays a role in cell division processes, though specific functional characterization requires further investigation.

What is known about Nitrosospira multiformis as a model organism for studying ammonia-oxidizing bacteria?

Nitrosospira multiformis is an important model organism for studying ammonia-oxidizing bacteria (AOB), which play a fundamental role in the nitrogen cycle within terrestrial, marine, and industrial microbial communities. These bacteria are responsible for the first step of nitrification - ammonia oxidation to nitrite .

Key features of N. multiformis include:

  • Genomic characteristics: The genome contains three nearly identical copies of ammonia monooxygenase (amo) and hydroxylamine oxidoreductase (hao) gene clusters as large repeats .

  • Distinctive features compared to other AOB: N. multiformis possesses gene clusters encoding urease and hydrogenase, a distinctive ribulose-bisphosphate carboxylase/oxygenase-encoding operon, and a relatively small complement of genes related to Fe acquisition . It also contains systems for synthesis of a pyoverdine-like siderophore and for acyl-homoserine lactone that are unique among sequenced AOB .

  • Proteome characterization: Approximately one-third of the predicted proteome is expressed under standard laboratory conditions, with proteins for key metabolic processes (ammonia oxidation and carbon fixation) being among the most abundant .

What are the optimal storage and handling conditions for recombinant Nmul_A2111?

For optimal storage and handling of recombinant Nmul_A2111:

Storage Conditions:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability

Handling Recommendations:

  • Avoid repeated freezing and thawing as this can compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

  • When designing experiments, consider preparing single-use aliquots to prevent degradation from freeze-thaw cycles

How can single-case experimental designs be applied to study Nmul_A2111 function?

Single-case experimental designs (SCEDs) represent a family of research approaches that can be valuable when studying protein function with limited resources or when investigating protein responses under varying conditions:

Reversal Design Application:
The reversal design collects data in at least two phases: a baseline phase (A) and an experimental phase (B) . For Nmul_A2111 studies, this might involve:

  • An A₁B₁A₂B₂ design where:

    • A₁: Baseline measurements of cellular function without Nmul_A2111

    • B₁: Introduction of recombinant Nmul_A2111

    • A₂: Removal or inhibition of Nmul_A2111

    • B₂: Reintroduction of Nmul_A2111

  • Comparing different protein concentrations or modified variants using designs such as A₁B₁C₁B₂C₂, where:

    • A represents control conditions

    • B and C represent different protein concentrations, modifications, or experimental conditions

This approach allows for multiple replications of treatment effects to establish experimental control and causal relationships between Nmul_A2111 and observed cellular responses.

What proteomics approaches are most effective for studying Nmul_A2111 expression and interactions?

Based on successful proteomics studies of ammonia-oxidizing bacteria, the following approaches are recommended:

1D-LC-MS/MS Proteomics:
This approach has been successfully used to compare the metabolism and physiology of three AOB species, including N. multiformis, under varying conditions . For Nmul_A2111 studies, this methodology can identify:

  • Expression levels under different environmental conditions

  • Post-translational modifications

  • Protein-protein interactions

Quantitative Proteomic Analysis:

  • Normalized Spectral Abundance Factor (NSAF) values can be used to compare Nmul_A2111 expression levels across different experimental conditions

  • Previous studies found that approximately one-third of the predicted proteome was expressed in N. multiformis under standard conditions

Comparative Proteomics:

  • Comparing orthologous genes across different AOB species can provide insights into functional conservation and specialization

  • This approach has revealed significant differences in the expression of proteins related to nitrogen metabolism, motility, cell growth, and stress response across AOB species

How does ammonia starvation affect Nmul_A2111 expression compared to other proteins in N. multiformis?

Research on ammonia starvation in N. multiformis has provided insights that may be relevant to Nmul_A2111 studies:

  • RuBisCO enzyme levels were consistently reduced after the starvation period, suggesting a decrease in capacity for biomass accumulation .

  • The red copper protein nitrosocyanin (NcyA), which is highly abundant in AOB, showed no significant difference in expression levels between control and starved conditions . The NSAF values for NcyA in N. multiformis were 1.99% in starved cultures compared to 1.80% in replete cultures (p > 0.05, t-test) .

  • When designing experiments to study Nmul_A2111 response to ammonia starvation, researchers should consider:

    • Extending the starvation period beyond 24 hours to potentially observe more pronounced effects

    • Examining other stress conditions that might elicit more dramatic proteome changes

    • Using comparative approaches across multiple AOB species to identify conserved stress responses

What experimental designs are most appropriate for studying post-translational modifications of Nmul_A2111?

Post-translational modifications, particularly S-nitrosation, may significantly affect Nmul_A2111 function. Based on studies of protein S-nitrosation in other systems:

Experimental Design Considerations:

  • Comparative Analysis Approaches:

    • Compare wild-type and mutant proteins with modified cysteine residues

    • Assess protein activity under normal conditions versus nitrosative stress

    • Analyze differential responses in various cellular compartments

  • Methodology for Detecting S-nitrosation:

    • Mass spectrometry-based approaches to identify specific S-nitrosated residues

    • Biotin-switch technique to detect S-nitrosated proteins

    • Spectrophotometric measurement of enzyme activity changes following S-nitrosation

  • Statistical Design Recommendations:

    • Ensure adequate sample size through power analysis

    • Consider multifactorial designs to examine interactions between different factors

    • Implement appropriate blocking or grouping of subjects to control for variability

S-nitrosation of proteins has been shown to modulate various cellular responses, including inhibition of key metabolic enzymes like cytosolic glyceraldehyde-3-phosphate dehydrogenase, methionine adenosyltransferase, and plasma membrane NADPH-oxidase activity . Similar modifications might affect Nmul_A2111 function.

How does Nmul_A2111 compare with similar proteins in other ammonia-oxidizing bacteria?

Comparative analysis of proteins across different AOB species can provide insights into Nmul_A2111's evolutionary conservation and functional significance:

Cross-Species Comparison:

While specific comparisons of Nmul_A2111 across species are not directly reported in the literature, the comparative proteomics approach used for other proteins can be applied:

  • Previous studies found that gene homologs from Nitrosomonas europaea and Nitrosomonas eutropha were the best match for 42% of the predicted genes in N. multiformis .

  • Significant differences in expression were observed for many abundant proteins across AOB species, including those related to:

    • Nitrogen metabolism (nitrite reductase)

    • Motility (flagellin)

    • Cell growth and division (FtsH)

    • Stress response (rubrerythrin)

  • Expression levels of cell division-related proteins varied significantly between species, with slower-growing species showing higher expression of division inhibitors and lower expression of promoters:

    • The MraZ transcriptional regulator (a division inhibitor) was more highly expressed in slower-growing N. ureae

    • The ATP-dependent zinc metalloprotease FtsH (involved in cell division) was most highly expressed in faster-growing N. europaea

What is the significance of highly expressed metabolic proteins in N. multiformis and how might this relate to Nmul_A2111 function?

Several highly expressed metabolic proteins in N. multiformis provide context for understanding the potential role of Nmul_A2111:

Key Metabolic Proteins in N. multiformis:

  • Ammonia Monooxygenase (AMO):

    • AMO subunit B was the most highly expressed protein in N. multiformis

    • Central to ammonia oxidation, the primary energy-generating pathway

  • Nitrosocyanin (NcyA):

    • Highly abundant in all three AOB species studied (1.7-2.3% of the proteomes)

    • Proposed to be part of the central ammonia oxidation pathway

    • May function enzymatically or through mediating electron transfer

    • Potential roles include recycling electrons from the quinone pool to AMO or functioning as a relay for electrons from hydroxylamine to oxygen

  • Pyrophosphate-dependent 6-phosphofructokinase:

    • Identified as the potential enzyme replacing the Calvin-Benson-Bassham cycle enzyme Fructose-1,6-bisphosphatase missing in N. multiformis

Understanding these key metabolic proteins and their interactions may provide context for investigating Nmul_A2111's role in N. multiformis cellular processes, particularly if it functions in coordination with these major metabolic pathways.

What genomic approaches could elucidate the evolutionary history of Nmul_A2111?

The genomic context of Nmul_A2111 may provide insights into its evolutionary history and functional significance:

Genomic Analysis Approaches:

  • Comparative Genomics:

    • N. multiformis contains regions with nucleotide composition anomalies (G+C content and dinucleotide and trinucleotide frequencies) that show evidence of recent lateral gene acquisition

    • Analysis of the genomic region containing Nmul_A2111 for such anomalies could indicate whether it was acquired through horizontal gene transfer or is ancestral to AOB

  • Repeat Analysis:

    • The N. multiformis chromosome has eight families of transposase-encoding insertion sequence elements (ISE) repeated throughout the genome

    • Determining whether Nmul_A2111 is associated with such repeats could provide insights into its mobility and conservation

  • Gene Neighborhood Analysis:

    • Examining genes adjacent to Nmul_A2111 may reveal functional associations

    • N. multiformis contains several gene clusters for storage and utilization of glycogen, polyphosphate, and cyanophycin that help meet energy requirements under substrate-limited conditions

How can researchers address potential experimental challenges when working with Nmul_A2111?

Based on research with similar proteins and ammonia-oxidizing bacteria, several experimental challenges may arise when studying Nmul_A2111:

Experimental Challenges and Solutions:

  • Protein Expression and Purification:

    • Challenge: Low yields or insolubility of recombinant protein

    • Solution: Optimize expression conditions, consider fusion tags that enhance solubility, or explore alternative expression systems

  • Functional Assays:

    • Challenge: Lack of known substrates or interaction partners

    • Solution: Employ broad screening approaches such as metabolite profiling or protein-protein interaction studies

  • Statistical Design:

    • Challenge: Determining appropriate sample size for experiments

    • Solution: Conduct power analysis based on expected effect size, variance, and desired power

    • Remember that sample size:

      • Increases with power

      • Increases with decreasing detectable difference

      • Increases proportionally to the variance

      • Requires larger numbers for two-sided tests than one-sided tests

  • Interpreting Proteomics Data:

    • Challenge: Distinguishing relevant biological changes from technical variability

    • Solution: Use appropriate normalization methods such as NSAF values for quantitative comparisons, and employ statistical approaches that account for multiple comparisons

What are the most promising research directions for understanding Nmul_A2111's role in nitrogen cycling?

Based on current understanding of N. multiformis and ammonia-oxidizing bacteria, several research directions could illuminate Nmul_A2111's role:

Promising Research Directions:

  • Protein-Protein Interaction Studies:

    • Identify potential interaction partners of Nmul_A2111, particularly among the highly expressed proteins involved in ammonia oxidation and carbon fixation

    • Methods could include co-immunoprecipitation, yeast two-hybrid, or pull-down assays

  • Gene Deletion/Complementation Studies:

    • Generate Nmul_A2111 knockout mutants and assess phenotypic changes

    • Complement with wild-type or modified versions to confirm function

  • Environmental Response Studies:

    • Examine how Nmul_A2111 expression changes under various environmental conditions beyond ammonia starvation

    • Particular focus on conditions relevant to nitrogen cycling in natural environments

  • Post-Translational Modification Analysis:

    • Investigate whether Nmul_A2111 undergoes S-nitrosation or other modifications

    • Assess how these modifications affect protein function and cellular responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.