The recombinant Nmul_A2111 protein (UniProt ID: Q2Y767) is derived from Nitrosospira multiformis, a chemolithoautotrophic soil bacterium critical to global nitrogen cycling . Key specifications include:
| Property | Details |
|---|---|
| Host organism | Escherichia coli |
| Tag | N-terminal His-tag |
| Molecular length | 181 amino acids (Full-length) |
| Purity | >90% (SDS-PAGE verified) |
| Storage | Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C |
| Reconstitution guidelines | 0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability |
The amino acid sequence is:
MKFLFDLFPVILFFITFKIYGIYAATAVAIGATFAQIGWVWFRHGKVDTMLWVSLVLIVVFGSATLILQDETFIKWKPSVLYWLFAAALLIAQAIFKKNFIRTMMKEQLTLPEPVWARVNASWAAFFAFMGAANLYVAFNYSTETWVNFKLFGFMGLMLVFVVLQGLMLSKYMATDEDKEA .
This recombinant protein is commercially available for:
Antibody development: Used as an antigen in ELISA kits (e.g., Creative BioMart’s $1,526 ELISA reagent) .
Structural studies: His-tag facilitates purification for crystallography or NMR.
Functional assays: Potential use in bacterial cell division or stress response studies, given its homology to E. coli YciB .
Uncharacterized pathways: While Nmul_A2111 is implicated in septation, its specific interactions and regulatory mechanisms remain undefined .
Ecological relevance: N. multiformis’s role in soil nitrification warrants further study of how septation proteins influence ammonia-oxidation efficiency under environmental stressors .
KEGG: nmu:Nmul_A2111
STRING: 323848.Nmul_A2111
Nmul_A2111 is a protein encoded by the Nitrosospira multiformis genome (strain ATCC 25196 / NCIMB 11849). It is classified as a probable intracellular septation protein A with a full length of 181 amino acids . The protein is part of the complete genome of N. multiformis, which consists of a circular chromosome and three small plasmids totaling 3,234,309 bp encoding 2,827 putative proteins . As an intracellular septation protein, it likely plays a role in cell division processes, though specific functional characterization requires further investigation.
Nitrosospira multiformis is an important model organism for studying ammonia-oxidizing bacteria (AOB), which play a fundamental role in the nitrogen cycle within terrestrial, marine, and industrial microbial communities. These bacteria are responsible for the first step of nitrification - ammonia oxidation to nitrite .
Key features of N. multiformis include:
Genomic characteristics: The genome contains three nearly identical copies of ammonia monooxygenase (amo) and hydroxylamine oxidoreductase (hao) gene clusters as large repeats .
Distinctive features compared to other AOB: N. multiformis possesses gene clusters encoding urease and hydrogenase, a distinctive ribulose-bisphosphate carboxylase/oxygenase-encoding operon, and a relatively small complement of genes related to Fe acquisition . It also contains systems for synthesis of a pyoverdine-like siderophore and for acyl-homoserine lactone that are unique among sequenced AOB .
Proteome characterization: Approximately one-third of the predicted proteome is expressed under standard laboratory conditions, with proteins for key metabolic processes (ammonia oxidation and carbon fixation) being among the most abundant .
For optimal storage and handling of recombinant Nmul_A2111:
Storage Conditions:
Store at -20°C for regular use
For extended storage, conserve at -20°C or -80°C
The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability
Handling Recommendations:
Avoid repeated freezing and thawing as this can compromise protein integrity
Working aliquots can be stored at 4°C for up to one week
When designing experiments, consider preparing single-use aliquots to prevent degradation from freeze-thaw cycles
Single-case experimental designs (SCEDs) represent a family of research approaches that can be valuable when studying protein function with limited resources or when investigating protein responses under varying conditions:
Reversal Design Application:
The reversal design collects data in at least two phases: a baseline phase (A) and an experimental phase (B) . For Nmul_A2111 studies, this might involve:
An A₁B₁A₂B₂ design where:
Comparing different protein concentrations or modified variants using designs such as A₁B₁C₁B₂C₂, where:
This approach allows for multiple replications of treatment effects to establish experimental control and causal relationships between Nmul_A2111 and observed cellular responses.
Based on successful proteomics studies of ammonia-oxidizing bacteria, the following approaches are recommended:
1D-LC-MS/MS Proteomics:
This approach has been successfully used to compare the metabolism and physiology of three AOB species, including N. multiformis, under varying conditions . For Nmul_A2111 studies, this methodology can identify:
Expression levels under different environmental conditions
Post-translational modifications
Protein-protein interactions
Quantitative Proteomic Analysis:
Normalized Spectral Abundance Factor (NSAF) values can be used to compare Nmul_A2111 expression levels across different experimental conditions
Previous studies found that approximately one-third of the predicted proteome was expressed in N. multiformis under standard conditions
Comparative Proteomics:
Comparing orthologous genes across different AOB species can provide insights into functional conservation and specialization
This approach has revealed significant differences in the expression of proteins related to nitrogen metabolism, motility, cell growth, and stress response across AOB species
Research on ammonia starvation in N. multiformis has provided insights that may be relevant to Nmul_A2111 studies:
RuBisCO enzyme levels were consistently reduced after the starvation period, suggesting a decrease in capacity for biomass accumulation .
The red copper protein nitrosocyanin (NcyA), which is highly abundant in AOB, showed no significant difference in expression levels between control and starved conditions . The NSAF values for NcyA in N. multiformis were 1.99% in starved cultures compared to 1.80% in replete cultures (p > 0.05, t-test) .
When designing experiments to study Nmul_A2111 response to ammonia starvation, researchers should consider:
Extending the starvation period beyond 24 hours to potentially observe more pronounced effects
Examining other stress conditions that might elicit more dramatic proteome changes
Using comparative approaches across multiple AOB species to identify conserved stress responses
Post-translational modifications, particularly S-nitrosation, may significantly affect Nmul_A2111 function. Based on studies of protein S-nitrosation in other systems:
Experimental Design Considerations:
Comparative Analysis Approaches:
Methodology for Detecting S-nitrosation:
Statistical Design Recommendations:
S-nitrosation of proteins has been shown to modulate various cellular responses, including inhibition of key metabolic enzymes like cytosolic glyceraldehyde-3-phosphate dehydrogenase, methionine adenosyltransferase, and plasma membrane NADPH-oxidase activity . Similar modifications might affect Nmul_A2111 function.
Comparative analysis of proteins across different AOB species can provide insights into Nmul_A2111's evolutionary conservation and functional significance:
Cross-Species Comparison:
While specific comparisons of Nmul_A2111 across species are not directly reported in the literature, the comparative proteomics approach used for other proteins can be applied:
Previous studies found that gene homologs from Nitrosomonas europaea and Nitrosomonas eutropha were the best match for 42% of the predicted genes in N. multiformis .
Significant differences in expression were observed for many abundant proteins across AOB species, including those related to:
Expression levels of cell division-related proteins varied significantly between species, with slower-growing species showing higher expression of division inhibitors and lower expression of promoters:
Several highly expressed metabolic proteins in N. multiformis provide context for understanding the potential role of Nmul_A2111:
Key Metabolic Proteins in N. multiformis:
Ammonia Monooxygenase (AMO):
Nitrosocyanin (NcyA):
Highly abundant in all three AOB species studied (1.7-2.3% of the proteomes)
Proposed to be part of the central ammonia oxidation pathway
May function enzymatically or through mediating electron transfer
Potential roles include recycling electrons from the quinone pool to AMO or functioning as a relay for electrons from hydroxylamine to oxygen
Pyrophosphate-dependent 6-phosphofructokinase:
Understanding these key metabolic proteins and their interactions may provide context for investigating Nmul_A2111's role in N. multiformis cellular processes, particularly if it functions in coordination with these major metabolic pathways.
The genomic context of Nmul_A2111 may provide insights into its evolutionary history and functional significance:
Genomic Analysis Approaches:
Comparative Genomics:
N. multiformis contains regions with nucleotide composition anomalies (G+C content and dinucleotide and trinucleotide frequencies) that show evidence of recent lateral gene acquisition
Analysis of the genomic region containing Nmul_A2111 for such anomalies could indicate whether it was acquired through horizontal gene transfer or is ancestral to AOB
Repeat Analysis:
Gene Neighborhood Analysis:
Based on research with similar proteins and ammonia-oxidizing bacteria, several experimental challenges may arise when studying Nmul_A2111:
Experimental Challenges and Solutions:
Protein Expression and Purification:
Functional Assays:
Challenge: Lack of known substrates or interaction partners
Solution: Employ broad screening approaches such as metabolite profiling or protein-protein interaction studies
Statistical Design:
Interpreting Proteomics Data:
Based on current understanding of N. multiformis and ammonia-oxidizing bacteria, several research directions could illuminate Nmul_A2111's role:
Promising Research Directions:
Protein-Protein Interaction Studies:
Identify potential interaction partners of Nmul_A2111, particularly among the highly expressed proteins involved in ammonia oxidation and carbon fixation
Methods could include co-immunoprecipitation, yeast two-hybrid, or pull-down assays
Gene Deletion/Complementation Studies:
Generate Nmul_A2111 knockout mutants and assess phenotypic changes
Complement with wild-type or modified versions to confirm function
Environmental Response Studies:
Examine how Nmul_A2111 expression changes under various environmental conditions beyond ammonia starvation
Particular focus on conditions relevant to nitrogen cycling in natural environments
Post-Translational Modification Analysis: