Recombinant Nitrosospira multiformis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function in Cell Wall Biosynthesis

Undecaprenyl-diphosphatase plays a crucial role in bacterial cell wall biosynthesis. Specifically, uppP catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) . This reaction represents a critical step in the peptidoglycan synthesis pathway, which is essential for bacterial cell wall integrity and function.

The biochemical pathway involves:

  1. Formation of farnesyl diphosphate (FPP) from isopentenyl diphosphate

  2. Conversion of FPP to undecaprenyl diphosphate (UPP) by undecaprenyl diphosphate synthase (UPPS)

  3. Dephosphorylation of UPP to UP by undecaprenyl diphosphate phosphatase (UPPP/uppP)

This enzymatic cascade is essential for bacterial survival, as the resulting UP serves as a lipid carrier for cell wall precursors during peptidoglycan assembly.

Significance in Nitrosospira multiformis

Nitrosospira multiformis is an ammonia-oxidizing bacterium (AOB) that plays important roles in environmental nitrogen cycling. While much research on N. multiformis has focused on its ammonia oxidation capabilities, the cell wall biosynthesis enzymes like uppP are equally crucial for the organism's growth and survival .

Comparative proteomics studies of N. multiformis have revealed approximately one-third of the predicted proteome is expressed under standard growth conditions . Although specific expression data for uppP in N. multiformis is limited in the available search results, the protein has been identified in proteomic analyses and is registered in protein databases with the UniProt ID Q2Y6P3 .

Inhibitor Development

Undecaprenyl diphosphate phosphatase represents an attractive target for antimicrobial development for several reasons:

  1. It catalyzes an essential step in bacterial cell wall biosynthesis

  2. The enzyme is not found in humans, reducing potential off-target effects

  3. Inhibition of uppP can lead to bacterial cell growth inhibition

Research has demonstrated that several compounds, including benzoic acids and phenylphosphonic acids, can inhibit undecaprenyl diphosphate phosphatase. One notable inhibitor, 5-fluoro-2-(3-(octyloxy)benzamido)benzoic acid, has shown significant activity with an ED50 of approximately 0.15 μg/mL .

Synergistic Effects with Other Antibiotics

Inhibitors targeting uppP have demonstrated synergistic effects when combined with established antibiotics that target bacterial cell wall biosynthesis. This synergism is evidenced by favorable fractional inhibitory concentration indices (FICI) of approximately 0.35 on average . In contrast, combinations with antibiotics targeting non-cell wall biosynthesis pathways showed indifferent effects (FICI approximately 1.45) .

This synergistic potential makes uppP inhibitors promising candidates for combination therapies to combat antibiotic resistance.

Recombinant Production System

The recombinant Nitrosospira multiformis uppP protein is typically produced in E. coli expression systems . The addition of an N-terminal histidine tag allows for efficient purification using affinity chromatography techniques. This approach yields purified protein with greater than 90% purity as determined by SDS-PAGE analysis .

The expression in a heterologous host like E. coli offers several advantages:

  1. High yield of target protein

  2. Well-established protocols for induction and purification

  3. Ability to add fusion tags for detection and purification

  4. Scalable production process

Nitrosospira multiformis as a Model Organism

Nitrosospira multiformis is an ammonia-oxidizing bacterium that has been used as a model organism in various studies focusing on nitrogen metabolism. Recent proteomic analyses have provided insights into the protein expression profiles of N. multiformis under different conditions .

Comparative Analysis with Other Bacterial Species

Some notable differences in enzyme expression between the species include:

  1. Copper resistance protein CopC being more highly expressed in N. multiformis (0.70%) compared to N. europaea (0.18%) or N. ureae (0.093%)

  2. Different expression patterns of cell division proteins like FtsH, with N. europaea showing higher expression (0.13%) compared to N. multiformis (0.04%) and N. ureae (0.01%)

These differences in protein expression patterns highlight the unique adaptations of each species to their ecological niches.

Current Research Applications

Recombinant Nitrosospira multiformis uppP has several important research applications:

  1. Structural studies: The purified protein enables detailed structural analysis using techniques like X-ray crystallography and cryo-electron microscopy.

  2. Inhibitor screening: The availability of recombinant uppP facilitates high-throughput screening for novel inhibitors with antimicrobial potential.

  3. Enzymatic characterization: The purified enzyme allows for detailed kinetic studies to better understand its catalytic mechanism.

  4. Comparative biochemistry: Comparison with uppP from other bacterial species can provide insights into evolutionary adaptations.

Future Research Directions

Several promising research directions could enhance our understanding of N. multiformis uppP:

  1. Structure-based drug design: Determination of the protein's three-dimensional structure would facilitate rational design of specific inhibitors.

  2. Metabolic engineering: Understanding the role of uppP in cell wall biosynthesis could inform strategies for bacterial engineering.

  3. Environmental adaptation studies: Investigation of how uppP expression and activity change under different environmental conditions could provide insights into bacterial adaptation mechanisms.

  4. Combination therapy development: Further exploration of synergistic effects between uppP inhibitors and established antibiotics could lead to new therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Nmul_A2286; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Target Names
uppP
Target Protein Sequence
MDWFLLLKGLILGIVEGLTEFLPISSTGHLILVSDLLNFNDEKGKVFTIVIQLGAILAVC WEYRVKLRHVVTDIGSRQDANRFVLNLLIAFLPAAILGLLFIKTIKQYLFHPVPVALAFI VGGLLILWAERRPHVVDVERVEDMDWKHALKVGLAQCLALIPGTSRSGATIIGGLFFGLS RKAATEFSFFLAIPVMFAATFYDLYKNRDILHLDDASVFAIGFVASFISALLAVRGLLRF VSQHDFSVFAWYRIGFGIIVLITAYSGMVQWSG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is uppP and what is its function in bacterial cell wall synthesis?

Undecaprenyl pyrophosphate phosphatase (uppP) is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (Und-P), which serves as an essential carrier lipid in bacterial cell wall synthesis . In bacteria like Nitrosospira multiformis, this enzyme plays a critical role in peptidoglycan biosynthesis by ensuring the recycling of the lipid carrier. The 55-carbon polyisoprenoid lipid carrier (UPP) is initially synthesized by UppS through consecutive condensation reactions and must be dephosphorylated by UPP phosphatases to generate Und-P, which then serves as the substrate for cell wall precursor synthesis . Without this conversion, bacteria cannot effectively transport peptidoglycan precursors across the cell membrane, ultimately compromising cell wall integrity and bacterial viability.

How does Nitrosospira multiformis uppP compare to uppP in other bacterial species?

Nitrosospira multiformis uppP shares key functional characteristics with uppP proteins from other bacterial species, particularly the presence of conserved active site motifs. In well-studied species like Escherichia coli, sequence alignments have revealed two consensus regions containing glutamate-rich (E/Q)XXXE plus PGXSRSXXT motifs and a conserved histidine residue . These regions are thought to be localized near the aqueous interface of uppP and oriented toward the periplasmic site, suggesting that the enzyme's biological function occurs on the outer side of the plasma membrane. Comparative analysis between Nitrosospira multiformis uppP and other bacterial uppP enzymes can provide insights into evolutionary conservation of this critical enzyme family across diverse bacterial taxa.

What methods can be used to express and purify recombinant Nitrosospira multiformis uppP?

The expression and purification of Nitrosospira multiformis uppP presents challenges typical of membrane proteins. Based on protocols developed for E. coli uppP, researchers can adapt the following methodology:

  • Expression system selection: An E. coli C41(DE3) expression system has proven effective for bacterial uppP proteins . This strain is optimized for membrane protein expression.

  • Vector design: Expression vectors should include appropriate tags for purification and detection. For E. coli uppP, bacteriorhodopsin has been successfully used as a fusion tag at the N-terminus .

  • Culture conditions: Growth in LB medium containing appropriate antibiotics at 37°C until OD600 reaches approximately 0.9, followed by induction with IPTG (typically 0.5 mM) for 4-5 hours .

  • Membrane isolation: Cells should be disrupted by mechanical methods (such as cell disruption systems), and membranes collected by ultracentrifugation at high speed (40,000 rpm for 1.5 hours) .

  • Solubilization: Membrane proteins require careful solubilization with appropriate detergents. For uppP, detergents like n-dodecyl-β-D-maltopyranoside (DDM) have been effective .

  • Purification: Affinity chromatography based on the chosen tag, followed by size exclusion chromatography to improve purity.

How can the enzymatic activity of Nitrosospira multiformis uppP be measured?

The enzymatic activity of uppP can be measured using a phosphate colorimetric assay that quantifies the release of inorganic phosphate during the dephosphorylation reaction. A typical reaction mixture contains:

  • Buffer system: 50 mM HEPES at pH 7.0

  • Salt: 150 mM NaCl

  • Divalent cation: 10 mM MgCl₂

  • Purified enzyme: Carefully titrated amounts

  • Substrate: Undecaprenyl pyrophosphate at appropriate concentrations

  • Detection reagent: Phosphate colorimetric assay kit (e.g., BioVision)

The reaction is typically carried out at physiologically relevant temperatures (30-37°C) for a specified time period, after which the released phosphate is quantified spectrophotometrically. Control reactions without enzyme or substrate should always be included to account for background phosphate release.

What approaches can be used for structure-function analysis of Nitrosospira multiformis uppP?

Several complementary approaches can be employed for structure-function analysis:

  • Site-directed mutagenesis: Targeting conserved residues in the (E/Q)XXXE and PGXSRSXXT motifs, as well as the conserved histidine, to assess their roles in catalysis . Mutations can be designed to alter charge, polarity, or size of the amino acid side chains.

  • Computational modeling: In the absence of crystal structures, computational approaches like Rosetta membrane ab initio modeling can generate structural models . These models can identify potential substrate binding sites and guide experimental designs.

  • Molecular dynamics simulations: These can provide insights into protein dynamics, substrate binding, and conformational changes associated with catalysis.

  • Topology analysis: Techniques like cysteine scanning mutagenesis combined with membrane-impermeable thiol-reactive reagents can help determine the membrane topology and accessibility of specific residues.

  • Inhibitor studies: Testing known UPP phosphatase inhibitors (such as bacitracin) can provide insights into the catalytic mechanism and substrate binding site.

How does uppP contribute to antibiotic resistance mechanisms?

Undecaprenyl pyrophosphate phosphatases play significant roles in antibiotic resistance, particularly against antibiotics that target the lipid II cycle of bacterial cell wall synthesis. Bacitracin, a widely used antibiotic, functions by binding tightly to the pyrophosphate group on surface-exposed UPP, thereby inhibiting its dephosphorylation . This prevents the recycling of the lipid carrier needed for cell wall synthesis.

In Bacillus subtilis, the expression of BcrC, one of its UPP phosphatases, is upregulated in response to cell envelope stress through the σᴹ-dependent stress response . This increased expression of UPP phosphatase activity contributes to bacitracin resistance by rapidly converting UPP (the target of bacitracin) to Und-P . By extrapolation, Nitrosospira multiformis uppP may similarly contribute to antibiotic resistance mechanisms, though species-specific studies would be needed to confirm this hypothesis.

A comprehensive understanding of how Nitrosospira multiformis uppP contributes to antibiotic resistance could inform the development of new antimicrobial strategies or combination therapies that overcome such resistance mechanisms.

What is the significance of uppP redundancy in bacterial systems and how might this apply to Nitrosospira multiformis?

Studies in Bacillus subtilis have revealed functional redundancy among UPP phosphatases. Using CRISPR interference (CRISPRi) approaches, researchers demonstrated that B. subtilis requires either of two UPP phosphatases, UppP or BcrC, for viability . Additionally, a third predicted lipid phosphatase (YodM) with homology to diacylglycerol pyrophosphatases could support growth when overexpressed .

This redundancy may represent an evolutionary strategy to ensure the essential process of lipid carrier recycling remains functional under various growth conditions or stress situations. Different UPP phosphatases might be optimized for specific environmental conditions, membrane compositions, or in response to particular stressors.

For Nitrosospira multiformis, genomic analysis could reveal whether similar redundant systems exist. Understanding the regulatory networks controlling uppP expression and the potential existence of functional homologs would provide insights into how this ammonia-oxidizing bacterium maintains cell envelope integrity under varying environmental conditions.

How can heterologous expression systems be optimized for functional studies of Nitrosospira multiformis uppP?

Optimizing heterologous expression systems for Nitrosospira multiformis uppP requires addressing several challenges:

  • Codon optimization: Adapting the codon usage of the uppP gene to match the preferred codons of the expression host can significantly improve protein yields.

  • Membrane integration efficiency: Fusion partners or signal sequences that enhance membrane targeting and integration may improve proper folding and activity of the recombinant protein.

  • Expression temperature: Lower temperatures (16-25°C) often improve the folding of membrane proteins and reduce inclusion body formation.

  • Induction conditions: Careful titration of inducer concentration and induction time can optimize the balance between protein expression and proper membrane integration.

  • Detergent screening: A systematic screen of detergents for solubilization and purification is critical for maintaining enzymatic activity. This should include various types of detergents (non-ionic, zwitterionic, etc.) at different concentrations.

  • Lipid supplementation: Addition of specific lipids during purification or activity assays may help maintain the native conformation and activity of the enzyme.

What are common challenges in working with recombinant Nitrosospira multiformis uppP and how can they be addressed?

ChallengeCauseSolution
Low expression yieldProtein toxicity, poor membrane integrationUse tight expression control systems, C41/C43 E. coli strains, lower induction temperature (18-25°C)
Loss of activity during purificationDetergent-induced conformational changesScreen multiple detergents, maintain critical lipids, add stabilizing agents (glycerol, specific ions)
AggregationHydrophobic interactions, improper foldingInclude glycerol (20-50%) in buffers, optimize detergent:protein ratio, consider amphipols for stabilization
Substrate availabilityLimited commercial sources of undecaprenyl pyrophosphateConsider enzymatic synthesis of substrate using UppS, use fluorescent or radioactive analogs for increased sensitivity
Assay interferenceBackground phosphate contaminationUse ultrapure reagents, include multiple controls, consider alternative assay methods (e.g., HPLC-based)

How should researchers interpret and validate uppP enzymatic activity data?

Proper interpretation and validation of uppP enzymatic activity requires several considerations:

  • Enzyme kinetics characterization: Determine Km and Vmax values under standardized conditions to allow meaningful comparisons between wild-type and mutant variants or between different experimental conditions.

  • Control reactions: Include no-enzyme controls, heat-inactivated enzyme controls, and substrate-free controls to account for non-enzymatic phosphate release or contaminating phosphatase activities.

  • Substrate specificity: Test activity against alternative substrates (if available) to confirm specificity for undecaprenyl pyrophosphate.

  • pH and temperature optima: Establish the optimal conditions for enzymatic activity and ensure that comparative studies are performed under these conditions.

  • Detergent effects: Systematically evaluate how different detergents and detergent concentrations affect enzyme activity, as these can significantly impact membrane protein function.

  • Validation across methods: When possible, validate activity measurements using orthogonal techniques, such as HPLC-based substrate depletion assays or coupled enzyme assays.

What emerging technologies could advance the study of Nitrosospira multiformis uppP?

Several cutting-edge technologies hold promise for advancing uppP research:

  • Cryo-electron microscopy: This technique is increasingly successful with membrane proteins and could provide structural insights into uppP without the need for crystallization.

  • Native mass spectrometry: Advanced MS techniques can analyze membrane proteins in their native lipid environments, potentially revealing lipid-protein interactions crucial for uppP function.

  • Single-molecule enzymology: These approaches could provide unprecedented insights into the kinetics and conformational changes of individual uppP molecules during catalysis.

  • Nanodiscs and lipid cubic phase technologies: These platforms provide more native-like membrane environments for studying uppP structure and function compared to detergent-solubilized preparations.

  • CRISPR interference (CRISPRi): As demonstrated with Bacillus subtilis UPP phosphatases, CRISPRi provides powerful tools for investigating essential genes and functional redundancy in bacterial systems .

How might understanding Nitrosospira multiformis uppP contribute to broader research fields?

Research on Nitrosospira multiformis uppP has potential implications for:

  • Antimicrobial development: As UPP phosphatases are essential for bacterial cell wall synthesis, they represent promising targets for new antibiotics. Understanding the structure and mechanism of uppP could guide the development of specific inhibitors.

  • Soil microbiology: Nitrosospira multiformis is an ammonia-oxidizing bacterium important in nitrogen cycling. Understanding its cell wall biosynthesis pathways may provide insights into its ecological adaptations and resilience in soil environments.

  • Comparative biochemistry: Comparing uppP across diverse bacterial species can reveal evolutionary patterns in essential cellular processes and how they've adapted to different ecological niches.

  • Synthetic biology: Detailed knowledge of cell envelope biosynthesis could inform efforts to engineer bacterial cell surfaces for biotechnological applications, including vaccine development and biocatalysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.