Recombinant Niviventer culturatus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Niviventer culturatus (Oldfield white-bellied rat)
Target Names
Target Protein Sequence
MAYTFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYVISLMLTTKLTHTNTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV and succinate dehydrogenase (Complex II), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. Specifically, cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) of subunit 2 and heme a of subunit 1 to the active site (a binuclear center – BNC – comprised of heme a3 and copper B (CuB)) in subunit 1. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (MT-CO2) and what is its functional significance?

Cytochrome c oxidase subunit 2 (MT-CO2) is a highly conserved protein encoded by the mitochondrial genome that plays a crucial role in cellular respiration. It functions as an integral component of the cytochrome c oxidase complex (COX), specifically mediating the initial transfer of electrons from cytochrome c to the cytochrome c oxidase complex, which is essential for ATP production during oxidative phosphorylation . The protein consists of 227 amino acids in Niviventer culturatus (Oldfield white-bellied rat) and contains specific domains responsible for interaction with other components of the electron transport chain . As a mitochondrial-encoded protein, MT-CO2 is subject to distinct evolutionary pressures compared to nuclear-encoded proteins, making it an interesting subject for both functional and evolutionary studies.

How is recombinant MT-CO2 typically expressed and purified for research applications?

Recombinant MT-CO2 is typically expressed in bacterial systems, predominantly in E. coli, using molecular cloning techniques . The process generally involves:

  • Cloning the MT-CO2 gene into an expression vector with an appropriate tag (commonly His-tag for easier purification)

  • Transformation into a suitable E. coli strain, often BL21(DE3)

  • Induction of protein expression using IPTG or similar inducers

  • Cell lysis to release the recombinant protein

  • Purification using immobilized metal affinity chromatography (IMAC), typically with Ni-NTA columns that bind the His-tag

  • Elution and concentration of the purified protein

  • Lyophilization for long-term storage

The recombinant protein is typically validated using SDS-PAGE to confirm purity greater than 90% . For the Niviventer culturatus MT-CO2 specifically, the protein is expressed with an N-terminal His-tag in E. coli and provided as a lyophilized powder in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the optimal conditions for reconstitution and storage of recombinant Niviventer culturatus MT-CO2?

For optimal reconstitution of lyophilized Niviventer culturatus MT-CO2:

  • First centrifuge the vial briefly to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being recommended by suppliers)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

Storage recommendations:

  • Long-term storage: -20°C to -80°C with proper aliquoting

  • Working aliquots: Can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this can lead to protein degradation

These specific conditions help maintain protein stability and functional integrity. The addition of trehalose (6%) in the storage buffer serves as a cryoprotectant that helps prevent protein denaturation during freeze-thaw cycles by stabilizing the protein's tertiary structure.

What experimental approaches are optimal for studying MT-CO2 protein interactions in cellular respiration research?

To study MT-CO2 interactions in cellular respiration, researchers can employ several complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down His-tagged MT-CO2 and identify interacting partners

    • Western blotting can verify known interactions

    • Mass spectrometry can identify novel binding partners

  • Proximity Labeling:

    • Fusion of MT-CO2 with promiscuous biotin ligases (BioID or APEX2)

    • Allows identification of proteins in close proximity in living cells

    • Particularly useful for transient interactions

  • Fluorescence Resonance Energy Transfer (FRET):

    • Engineer fluorescent tagged versions of MT-CO2 and potential interaction partners

    • Detect energy transfer between fluorophores when proteins interact

    • Can be measured in live cells to assess dynamic interactions

  • Protein Transduction Technology:

    • Use cell-penetrating peptides like TAT-HA to introduce recombinant MT-CO2 into mammalian cells

    • Follow the protocol described for recombinant fluorescent TAT-HA-tagged proteins

    • Monitor localization and function using the attached fluorescent tags

  • Oxygen Consumption Assays:

    • Measure cellular respiration rates using high-resolution respirometry

    • Compare wild-type MT-CO2 with mutant or variant forms

    • Assess functional consequences of sequence variations or post-translational modifications

Each of these approaches provides unique insights into MT-CO2 function and should be selected based on the specific research question being addressed.

How can researchers effectively transduce recombinant MT-CO2 protein into mammalian cells for functional studies?

For effective transduction of recombinant MT-CO2 into mammalian cells, researchers can utilize the TAT-HA cell-penetrating peptide approach. The following methodology is recommended:

  • Protein Engineering:

    • Construct an expression vector containing the MT-CO2 gene fused with:

      • TAT-HA penetrating peptide sequence

      • 6×His tag for purification

      • EGFP or mCherry for fluorescent monitoring

  • Protein Production and Purification:

    • Express the fusion protein in E. coli BL21(DE3) cells

    • Purify using immobilized metal affinity chromatography (IMAC) with a Ni-NTA column

    • Verify purity by SDS-PAGE and Western blotting

  • Cell Transduction Protocol:

    • Prepare mammalian cells at 70-80% confluency

    • Wash cells with serum-free media

    • Add purified TAT-HA-MT-CO2 protein to media at concentrations of 1-10 μg/ml

    • Incubate for 1-4 hours at 37°C

    • Wash cells thoroughly to remove extracellular protein

    • Return cells to complete media for subsequent analysis

  • Verification of Transduction:

    • Confirm protein uptake through fluorescence microscopy (tracking EGFP/mCherry signal)

    • Perform subcellular fractionation to verify mitochondrial localization

    • Western blot using anti-His or anti-MT-CO2 antibodies to confirm protein integrity

This approach allows for rapid introduction of the recombinant protein without genetic manipulation of the target cells, enabling functional studies and comparison between variant forms of MT-CO2 .

What are the recommended approaches for troubleshooting expression and purification issues with recombinant MT-CO2?

When encountering difficulties with expression and purification of recombinant MT-CO2, consider the following troubleshooting approaches:

  • Low Expression Levels:

    • Optimize codon usage for E. coli

    • Test different E. coli strains (BL21, Rosetta, C41/C43 for membrane proteins)

    • Reduce expression temperature (16-25°C)

    • Optimize induction conditions (IPTG concentration, induction time)

    • Try different solubility tags (SUMO, MBP, GST) in addition to His-tag

  • Protein Insolubility:

    • Add mild detergents during lysis (0.1% Triton X-100, n-Dodecyl β-D-maltoside)

    • Include stabilizing agents (glycerol, trehalose) in buffer

    • Test different lysis methods (sonication vs. enzymatic)

    • Express as fusion with solubility-enhancing partners

  • Poor Purification Yield:

    • Optimize imidazole concentration in binding/washing/elution buffers

    • Adjust pH and salt concentration

    • Consider longer binding times with the Ni-NTA resin

    • Test different metal ions for IMAC (Ni²⁺, Co²⁺, Cu²⁺)

  • Protein Degradation:

    • Add protease inhibitors during all purification steps

    • Maintain samples at 4°C throughout purification

    • Include reducing agents if oxidation is suspected

    • Process samples quickly and avoid unnecessary delays

  • Verifying Protein Identity and Purity:

    • SDS-PAGE analysis (expect >90% purity)

    • Western blot with anti-His or anti-MT-CO2 antibodies

    • Mass spectrometry to confirm protein identity

    • Size exclusion chromatography to assess oligomeric state

Remember that mitochondrial proteins like MT-CO2 may require special considerations due to their hydrophobicity and normal membrane association. The inclusion of 6% trehalose in storage buffer, as noted in the product specifications, helps maintain protein stability during storage .

How can researchers design experiments to study the effects of cytochrome c oxidase dysfunction using recombinant MT-CO2?

To study cytochrome c oxidase dysfunction using recombinant MT-CO2, researchers can design experiments that assess both structural and functional aspects:

  • Dominant Negative Approach:

    • Introduce mutant recombinant MT-CO2 into cells to compete with endogenous protein

    • Use the TAT-HA transduction method for efficient protein delivery

    • Compare mitochondrial function between cells treated with wild-type versus mutant MT-CO2

    • Assess:

      • Oxygen consumption rates

      • ATP production

      • Reactive oxygen species generation

      • Mitochondrial membrane potential

  • Mitochondrial Hybrid (Cybrid) Cell Models:

    • Generate cell lines with specific MT-CO2 variants

    • Introduce recombinant MT-CO2 to rescue function

    • Compare respiratory function between different cybrid lines

    • Measure enzyme kinetics of cytochrome c oxidase activity

  • In vitro Reconstitution Assays:

    • Isolate mitochondria from cells

    • Permeabilize outer membrane to allow access to cytochrome c

    • Add recombinant cytochrome c and measure electron transfer rates

    • Compare activity with native versus recombinant MT-CO2

  • Structural Studies:

    • Use purified recombinant MT-CO2 for crystallography or cryo-EM

    • Compare structures of wild-type and mutant proteins

    • Identify critical residues for function

  • Cell Viability Experiments:

    • Similar to the approach in search result , expose cells to stressors like hypoxia

    • Treat with different concentrations of recombinant MT-CO2 (e.g., 15 ng/ml and 150 ng/ml)

    • Assess cell viability using multiple complementary assays:

      • CellTiter-Blue Cell Viability Assay

      • CytoTox-Fluor Cytotoxicity Assay

      • PI/Hoechst staining

This multi-faceted approach allows researchers to comprehensively assess the role of MT-CO2 in cytochrome c oxidase function and dysfunction, potentially revealing mechanisms relevant to mitochondrial diseases.

What is known about the potential dual roles of cytochrome c and MT-CO2 in both respiration and apoptosis?

Research has revealed intriguing dual functions of cytochrome c in both cellular respiration and programmed cell death:

  • Respirator Role:

    • Cytochrome c serves as an electron carrier in the mitochondrial electron transport chain

    • MT-CO2 directly interacts with cytochrome c to facilitate electron transfer, essential for ATP production

    • This interaction represents the canonical function in healthy cells

  • Apoptotic Role:

    • When released from mitochondria into the cytoplasm, cytochrome c becomes a key trigger of apoptosis

    • It interacts with Apaf-1 to form the apoptosome, activating caspase cascades

    • MT-CO2 dysfunction may potentially contribute to apoptotic signaling

  • Extracellular Effects:

    • Research has shown that cytochrome c can be detected in cerebrospinal fluid (CSF) after brain injury

    • In rat models of cardiac arrest, cytochrome c levels in CSF increased significantly, peaking at approximately 6.9 ng/ml at 24 hours post-arrest

    • Paradoxically, experimental evidence suggests that exogenous cytochrome c can:
      a) Either trigger cell death when added to neuronal cultures in some conditions
      b) Or improve survival of neurons exposed to anoxia in other experimental settings

  • Therapeutic Implications:

    • External administration of cytochrome c (15-150 ng/ml) to primary neuronal cultures after hypoxia showed potential neuroprotective effects

    • The contradictory findings suggest complex context-dependent roles that warrant further investigation

These dual roles highlight the complexity of cytochrome c and potentially MT-CO2 functions beyond their canonical roles in respiration, suggesting both proteins may serve as signaling molecules in stress conditions.

How can evolutionary analysis of MT-CO2 sequences inform research on mitochondrial function and disease?

Evolutionary analysis of MT-CO2 sequences provides valuable insights into mitochondrial function and disease through several approaches:

  • Patterns of Conservation and Selection:

    • Studies of the COII gene in marine copepods revealed that despite its critical function, there can be up to 20% nucleotide divergence between populations, including numerous nonsynonymous substitutions

    • Most codons in MT-CO2 are under strong purifying selection (ω << 1), indicating functional constraints

    • Approximately 4% of sites appear to evolve under relaxed selective constraint (ω = 1)

    • Some sites may experience positive selection, particularly at interfaces with nuclear-encoded proteins

  • Mitonuclear Co-evolution:

    • MT-CO2 interacts extensively with nuclear-encoded subunits of cytochrome c oxidase and cytochrome c

    • Evolutionary analysis can identify co-evolving residues between mitochondrial and nuclear components

    • This co-evolution is critical because:

      • Mitochondrial DNA has a higher mutation rate than nuclear DNA

      • Compensatory mutations in nuclear-encoded partners may be necessary to maintain function

  • Applications to Research Design:

    • Identification of rapidly evolving sites guides mutagenesis studies

    • Understanding of naturally occurring variants helps interpret clinical findings

    • Comparative analysis across species can identify:

      • Functionally critical residues (highly conserved)

      • Adaptive residues (showing positive selection)

      • Neutral variations (under relaxed selection)

  • Disease Relevance:

    • MT-CO2 variants have been associated with mitochondrial disorders

    • Evolutionary analysis helps distinguish pathogenic mutations from benign polymorphisms

    • The study of branch-specific selection patterns can reveal lineage-specific adaptations that might inform therapeutic approaches

This evolutionary perspective provides a framework for understanding the functional significance of sequence variations in MT-CO2, guiding both basic research and clinical interpretations of mitochondrial genetics.

What are the critical quality control measures for ensuring recombinant MT-CO2 functional integrity?

To ensure recombinant MT-CO2 maintains its functional integrity for research applications, implement these critical quality control measures:

  • Purity Assessment:

    • SDS-PAGE analysis with expected purity >90%

    • Silver staining for detecting low-level contaminants

    • Western blot with specific antibodies against MT-CO2 and His-tag

    • Mass spectrometry to confirm correct sequence and identify potential modifications

  • Structural Verification:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Dynamic light scattering to detect aggregation

    • Limited proteolysis to verify proper folding

  • Functional Assays:

    • Cytochrome c binding assays using surface plasmon resonance

    • Electron transfer activity measurements

    • Reconstitution with other cytochrome oxidase subunits to assess complex formation

    • Oxygen consumption assays in reconstituted systems

  • Storage Stability Monitoring:

    • Accelerated stability testing at different temperatures

    • Regular activity testing of stored samples

    • Analysis of freeze-thaw effects using aliquots stored at -20°C/-80°C

    • Monitoring of pH stability in reconstitution buffer

  • Batch-to-Batch Consistency:

    • Standardized production protocols

    • Reference standards for comparative analysis

    • Lot-specific activity measurements

    • Documentation of production parameters

  • Endotoxin Testing:

    • LAL (Limulus Amebocyte Lysate) assay for endotoxin detection

    • Particularly important for applications involving cell culture

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.