Recombinant Nocardia farcinica NADH-quinone oxidoreductase subunit D (nuoD) is a protein component of the NADH:quinone oxidoreductase complex I, also known as NDH-1, which plays a crucial role in the respiratory chain of bacteria. This enzyme complex is responsible for transferring electrons from NADH to ubiquinone, contributing to the generation of a proton gradient across the bacterial membrane, which is essential for ATP synthesis .
The nuoD subunit is part of the hydrophilic domain of the NDH-1 complex and is involved in forming a quinone binding cavity along with neighboring subunits . The recombinant nuoD protein from Nocardia farcinica is expressed in Escherichia coli and has a purity of over 85% as determined by SDS-PAGE . The sequence of the nuoD protein includes several conserved amino acid residues that are important for its function .
Expression and Purity: The recombinant nuoD protein is expressed in E. coli with a purity of >85% .
Sequence: The protein sequence includes several conserved regions crucial for its function, such as MKDTETRPGRHRAPEPAHPEQPDTTGDTVVTVSGQDWDTV .
Storage Conditions: The shelf life of the liquid form is typically 6 months at -20°C/-80°C, while the lyophilized form can last up to 12 months under the same conditions .
| Characteristics | Description |
|---|---|
| Expression Host | Escherichia coli |
| Purity | >85% (SDS-PAGE) |
| Sequence | MKDTETRPGRHRAPEPAHPEQPDTTGDTVVTVSGQDWDTV... |
| Storage Conditions | Liquid: 6 months at -20°C/-80°C; Lyophilized: 12 months at -20°C/-80°C |
| Protein Length | Full-length protein (1-453 amino acids) |
| Subunit | Function | Species |
|---|---|---|
| nuoD | Part of quinone binding cavity | Nocardia farcinica, Escherichia coli |
| nuoK | Electron transfer component | Nocardia farcinica |
| NuoCD | Proton channel in peripheral arm | Escherichia coli |
KEGG: nfa:NFA_26640
STRING: 247156.nfa26640