Recombinant Nocardia farcinica Probable cytochrome c oxidase subunit 3 (ctaE)

What is Nocardia farcinica cytochrome c oxidase subunit 3 (ctaE) and what is its significance in bacterial metabolism?

Cytochrome c oxidase subunit 3 (ctaE) is an essential component of the terminal oxidase complex in the respiratory chain of Nocardia farcinica. This protein functions as part of the membrane-bound complex that catalyzes the transfer of electrons from cytochrome c to molecular oxygen, coupled with proton translocation across the membrane. In N. farcinica, this process is particularly important as it represents the final step in the electron transport chain and is critical for energy generation.

The ctaE protein in N. farcinica (UniProt accession: Q5YZ19) consists of 203 amino acids and is encoded by the ctaE gene (NFA_17260) . The protein's structure includes multiple transmembrane domains that anchor it within the bacterial membrane, allowing it to function within the respiratory complex. This respiratory function makes ctaE an important target for understanding N. farcinica metabolism and potentially for developing novel antimicrobial approaches against this pathogen.

What are the structural characteristics of the ctaE protein in Nocardia farcinica?

The probable cytochrome c oxidase subunit 3 (ctaE) from Nocardia farcinica has several key structural features that define its function:

• Amino acid composition: The full amino acid sequence is: MTTAVGTPGSAITQRVHSLNRPNMVSVGTIIWLSSELMFFAGLFAMYFVARAQANGNWPPEPTELNLKLAVPVTAVLVASSFTCQMGVFAAEKGDVFGLRRWYFITLLMGAFFVAGQGYEYYHLVHEGTSISSSAYGSVFYITTGFHGLHVIGGLIAFVFLLIRTKVSKFTPAQATAAIVVSYYWHFVDIVWIGLFATIYFVR

• Transmembrane domains: The protein contains multiple hydrophobic regions that form transmembrane helices, allowing it to be embedded in the bacterial membrane.

• Functional domains: ctaE contains regions involved in interaction with other subunits of the cytochrome c oxidase complex and domains that participate in electron transfer.

• Conservation: Certain regions of the protein show higher conservation across species, particularly in domains critical for the catalytic function of the enzyme.

The tertiary structure of the protein is characterized by a bundle of transmembrane helices that create a scaffold for the functional components of the cytochrome c oxidase complex. This three-dimensional arrangement is essential for proper electron transfer and proton pumping activities.

What expression systems are most effective for producing recombinant N. farcinica ctaE protein?

Several expression systems have been employed for the recombinant production of membrane proteins like ctaE, each with specific advantages depending on research objectives:

E. coli-based expression systems:

• BL21(DE3) strains with pET vector systems offer high yield but may require optimization for membrane protein expression

• C41(DE3) and C43(DE3) strains are specifically designed for toxic and membrane protein expression

• Codon-optimized constructs are essential due to the high GC content (70.78%) of N. farcinica genome

Alternative expression hosts:

• Mycobacterial expression systems may provide a more native-like environment for proper folding

• Cell-free expression systems can be advantageous for membrane proteins that are toxic to host cells

Expression considerations:

• Temperature reduction during induction (16-20°C) often improves proper folding

• Addition of specific detergents during extraction and purification is critical for maintaining protein structure and function

• Fusion tags such as His6 or MBP can improve solubility and facilitate purification

For maximum functional yield, a systematic approach testing multiple expression constructs and conditions is recommended, with functionality verified through activity assays specific to cytochrome c oxidase.

What are the optimal storage and handling conditions for recombinant ctaE protein?

Based on established protocols for similar proteins and specific information for recombinant ctaE, the following storage and handling conditions are recommended:

Short-term storage (1-2 weeks):

• Store at 4°C in Tris-based buffer containing 50% glycerol

• Include protease inhibitors to prevent degradation

• Maintain in detergent micelles to preserve membrane protein structure

Long-term storage:

• Store at -20°C or -80°C in small aliquots to avoid repeated freeze-thaw cycles

• Addition of stabilizing agents such as glycerol (≥50%) is critical

• Ensure complete removal of air from storage tubes to prevent oxidation

Critical handling considerations:

• Avoid repeated freeze-thaw cycles as they significantly reduce activity

• When thawing, allow protein to warm gradually at 4°C rather than at room temperature

• Working aliquots should be maintained at 4°C for no longer than one week

• Consider addition of reducing agents (e.g., DTT or β-mercaptoethanol) to prevent oxidation of sulfhydryl groups

These conditions must be validated for each specific preparation, as variations in construct design and purification methods may necessitate adjustments to optimal storage conditions.

How can researchers investigate the role of ctaE in Nocardia farcinica pathogenesis?

Investigation of ctaE's role in N. farcinica pathogenesis requires a multi-faceted approach:

Genetic manipulation strategies:

• Gene knockout/knockdown studies to create ctaE-deficient strains

• Complementation studies to verify phenotype restoration

• Site-directed mutagenesis of key residues to identify essential functional domains

Infection models:

• Cell culture models using relevant human cell lines (particularly macrophages, given N. farcinica's ability to proliferate in these cells)

• Animal infection models to assess virulence changes in ctaE-modified strains

• Ex vivo tissue models to study tissue-specific pathogenic mechanisms

Functional assays:

• Respiratory capacity measurements comparing wild-type and ctaE-modified strains

• Survival assessment under various stress conditions (oxidative stress, antimicrobial exposure)

• Metabolic profiling to determine changes in energy production pathways

These approaches should be integrated with analysis of clinical isolates, particularly those from immunocompromised patients who are most susceptible to N. farcinica infections . Research should particularly focus on the role of cytochrome c oxidase function in survival within macrophages, as N. farcinica is known to be a facultative intracellular pathogen that can proliferate in macrophages and polymorphonuclear leukocytes .

What methodologies are most effective for studying potential interactions between ctaE and antimicrobial agents?

Given N. farcinica's intrinsic resistance to multiple antimicrobial agents, understanding how ctaE might contribute to this resistance is important. The following methodologies are recommended:

Biochemical approaches:

• Direct binding assays between purified ctaE and antimicrobial compounds

• Enzymatic activity assays in the presence of various antimicrobials

• Structural studies (X-ray crystallography, cryo-EM) of ctaE in complex with inhibitors

Genetic approaches:

• Creation of ctaE variants with altered antimicrobial susceptibility profiles

• Transcriptomic analysis to identify compensatory mechanisms when ctaE is inhibited

• Suppressor mutant screens to identify genetic interactions with resistance mechanisms

Computational methods:

• Molecular docking studies to predict interactions between ctaE and antimicrobial compounds

• Molecular dynamics simulations to understand conformational changes upon binding

• Comparative genomics across clinical isolates with varying resistance profiles

Recent genomic analysis of N. farcinica has identified multiple antimicrobial resistance genes (RbpA, mtrA, FAR-1, blaFAR-1, blaFAR-1_1, and rox) , which should be considered in the context of ctaE function. The interaction between respiratory chain components like ctaE and these resistance mechanisms may provide insights into the multidrug resistance commonly observed in N. farcinica isolates.

What biophysical techniques are recommended for studying the structural properties of recombinant ctaE?

Understanding the structural properties of ctaE requires specialized approaches suitable for membrane proteins:

Spectroscopic methods:

• Circular dichroism (CD) spectroscopy for secondary structure analysis

• Fluorescence spectroscopy to monitor conformational changes

• FTIR spectroscopy for detailed secondary structure characterization in membrane environments

Advanced structural techniques:

• X-ray crystallography (challenging for membrane proteins, but possible with appropriate detergents or lipidic cubic phase methods)

• Cryo-electron microscopy for high-resolution structural determination

• Nuclear magnetic resonance (NMR) spectroscopy for dynamic structural information

Membrane protein-specific approaches:

• Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

• Electron paramagnetic resonance (EPR) spectroscopy to examine spatial relationships between domains

• Small-angle X-ray scattering (SAXS) for low-resolution envelope structures in solution

When designing experiments, researchers should consider the specific challenges of membrane proteins like ctaE, including the need for appropriate detergents or lipid environments to maintain native structure. The structural information obtained should be correlated with functional assays to establish structure-function relationships relevant to the protein's role in N. farcinica metabolism and pathogenesis.

How can researchers effectively measure the enzymatic activity of recombinant ctaE in vitro?

Measuring the enzymatic activity of cytochrome c oxidase subunit 3 requires specific assays that account for its role within the complete cytochrome c oxidase complex:

Oxygen consumption assays:

• Clark-type oxygen electrode measurements of reconstituted cytochrome c oxidase complex

• Fluorescence-based oxygen sensing systems for high-throughput analysis

• Coupled enzyme assays that monitor cytochrome c oxidation spectrophotometrically

Electron transfer measurements:

• Spectrophotometric monitoring of cytochrome c oxidation at 550 nm

• Stopped-flow kinetic analysis of electron transfer rates

• Electrochemical techniques to measure direct electron transfer

Proton pumping assays:

• pH-sensitive fluorescent dyes to monitor proton translocation

• Reconstitution into liposomes or nanodiscs for functional studies

• Patch-clamp techniques for direct measurement of proton currents

Data analysis table for activity measurements:

It's important to note that as a subunit of a larger complex, isolated ctaE may not show activity independently. Researchers should consider reconstituting ctaE with other subunits of the cytochrome c oxidase complex or using membrane fragments that contain the complete complex.

How can site-directed mutagenesis be used to investigate functional residues in ctaE?

Site-directed mutagenesis is a powerful approach for identifying critical functional residues in ctaE. The following methodological framework is recommended:

Target selection strategy:

• Identify conserved residues through multiple sequence alignment of ctaE across bacterial species

• Focus on residues in predicted functional domains (electron transfer, proton channels, subunit interfaces)

• Target residues implicated in antimicrobial resistance mechanisms

Mutagenesis approach:

• Conservative substitutions to test the importance of specific chemical properties

• Alanine scanning mutagenesis to systematically evaluate the contribution of side chains

• Introduction of charged residues to disrupt potential binding interfaces

Functional characterization:

• Enzymatic activity assays comparing wild-type and mutant proteins

• Thermal stability assessments to identify structurally important residues

• Binding studies with interaction partners or inhibitors

In vivo significance:

• Complementation studies in ctaE knockout strains

• Virulence assessment in infection models

• Antimicrobial susceptibility testing of strains expressing mutant variants

Based on the amino acid sequence provided (MTTAVGTPGSAITQRVHSLNRPNMVSVGTIIWLSSELMFFAGLFAMYFVARAQANGNWPPEPTELNLKLAVPVTAVLVASSFTCQMGVFAAEKGDVFGLRRWYFITLLMGAFFVAGQGYEYYHLVHEGTSISSSAYGSVFYITTGFHGLHVIGGLIAFVFLLIRTKVSKFTPAQATAAIVVSYYWHFVDIVWIGLFATIYFVR) , particular attention should be paid to highly conserved regions and transmembrane domains that are likely to be essential for function.

What approaches can be used to study potential interactions between ctaE and other components of the respiratory chain in Nocardia farcinica?

Understanding the interactions between ctaE and other respiratory chain components requires specialized techniques designed for membrane protein complexes:

Co-purification strategies:

• Tandem affinity purification using tags on different subunits

• Chemical cross-linking followed by mass spectrometry

• Pull-down assays with ctaE-specific antibodies or affinity tags

Biophysical interaction analyses:

• Surface plasmon resonance (SPR) for kinetic and affinity measurements

• Isothermal titration calorimetry (ITC) for thermodynamic parameters

• Microscale thermophoresis for interaction studies in complex solutions

Structural approaches:

• Cryo-electron microscopy of the intact cytochrome c oxidase complex

• Cross-linking mass spectrometry to map interaction interfaces

• Hydrogen-deuterium exchange to identify regions protected upon complex formation

Functional validation:

• Reconstitution of defined subunit combinations to assess minimal functional units

• Activity assays with systematically varied subunit stoichiometries

• Mutagenesis of predicted interaction interfaces followed by functional testing

When designing these experiments, researchers should consider the genomic context of the ctaE gene (NFA_17260) and identify other components of the respiratory chain that may interact with ctaE based on genomic proximity or known cytochrome c oxidase complex structures from related organisms.

How does ctaE function potentially contribute to Nocardia farcinica virulence and pathogenicity?

The relationship between respiratory function and pathogenicity in N. farcinica involves several potential mechanisms:

Metabolic adaptation:

• Cytochrome c oxidase activity may enable metabolic flexibility in different host environments

• The ability to maintain energy production under varying oxygen tensions could contribute to persistence

• Respiratory chain function may support survival within macrophages and polymorphonuclear leukocytes, where N. farcinica is known to proliferate

Stress response:

• Efficient respiratory function may provide resistance to oxidative stress encountered during infection

• The electron transport chain may contribute to detoxification of reactive oxygen species produced by host immune cells

• Energy generation through cytochrome c oxidase activity may support production of virulence factors

Potential connections to known virulence factors:

• N. farcinica genome analysis has identified virulence genes including relA, icl, and mbtH

• The metabolic capacity supported by ctaE function may enable expression of these virulence factors

• Energy production through respiratory chain function may be particularly important during chronic infection stages

Understanding ctaE's role in pathogenesis could help explain why N. farcinica is particularly problematic in immunocompromised hosts, including those with solid tumors, hematologic malignancies, transplant recipients, and patients on corticosteroid therapy . The protein's function may be especially important for survival in specific host niches encountered during disseminated infection.

What considerations are important when designing experiments to study ctaE in the context of clinical Nocardia farcinica infections?

When designing experiments to study ctaE in clinical contexts, researchers should consider:

Clinical isolate selection:

• Include isolates from diverse infection sites (pulmonary, central nervous system, soft tissue)

• Compare strains from immunocompromised and immunocompetent hosts

• Include isolates with varying antimicrobial resistance profiles

Relevant models:

• In vitro infection models using appropriate human cell types (alveolar macrophages, neutrophils)

• Ex vivo tissue models that recapitulate specific infection sites

• Animal models that mimic clinical manifestations of nocardiosis

Clinical correlation:

• Compare ctaE sequence and expression across clinical isolates with varying virulence

• Assess cytochrome c oxidase activity in isolates from different infection presentations

• Correlate respiratory chain function with clinical outcomes or treatment response

Experimental conditions:

• Simulate physiologically relevant conditions (oxygen tension, pH, nutrient availability)

• Consider the impact of commonly used antimicrobials on ctaE function

• Account for host factors that may modulate respiratory chain function

When conducting these studies, researchers should recognize the clinical significance of N. farcinica as an emerging pathogen in immunocompromised hosts and consider how cytochrome c oxidase function might contribute to the organism's ability to cause disseminated, life-threatening infections.