Recombinant Nocardia farcinica Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
lgt; NFA_18630; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Nocardia farcinica (strain IFM 10152)
Target Names
lgt
Target Protein Sequence
MTLRSDVLAYIPSPPQGVWHIGPIPLRAYALCIILGIVVAIWWGERRWQQRGGREGTVLD VAMFAVPFGLIGGRAYHVATDWRKYFGEGGNPVEALYIWQGGLGIWGAVFLGGIGAWIAC RIYRIPLPAFGDAIAPPILLAQAIGRLGNWFNQELYGRETTLPWGLEIYPRFDAAGDPDP MNGISNGVVEKIVHPTFLYELLWNVLVVIALVQLDKRFRIGHGRLFALYVAGYSFGRFFV ELMRDDEATLVAGIRINNFTSALVFLAAIAYFVFATKGREAPERLQPGGTTRPWPWQLAA LRAAGVAANGPAEPGATASTATDTDGDAKDTPPSDAAATGGQGTAAKGDRGTADAADTAK DASATDSASNSASATDSDFGETAGSSDDADRAAAVKAASGATAAEKSAADKESAAGEAAA DTSAADQPAADKSGSAKSAADKSAGKSGAGRGNESESTRDNESTSAGTAASATGSAGAGA TDRVDSGENDA
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of prolipoprotein diacylglyceryl transferase (Lgt) in Nocardia farcinica?

Prolipoprotein diacylglyceryl transferase (Lgt) in Nocardia farcinica is a critical enzyme involved in bacterial lipoprotein biosynthesis. It catalyzes the first step of post-translational lipid modification by transferring a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the "lipobox" motif of preprolipoproteins as they exit the Sec or Tat translocon . This modification is essential for proper localization and function of lipoproteins, which play crucial roles in bacterial physiology including cell envelope architecture maintenance, nutrient uptake, transmembrane signaling, adhesion, and virulence .

The importance of Lgt varies across bacterial species. While deletion of the lgt gene is lethal to most Gram-negative bacteria, suggesting its essential nature , its significance in Nocardia farcinica requires further investigation. By understanding Lgt function in N. farcinica, researchers can potentially exploit this pathway for therapeutic interventions against nocardiosis.

How does Lgt contribute to Nocardia farcinica pathogenicity?

Lgt significantly contributes to N. farcinica pathogenicity through its role in lipoprotein processing. Properly processed lipoproteins facilitate bacterial invasion of host cells and modulation of immune responses. In N. farcinica, virulence factors like Nfa34810 (which has been predicted to be a virulence factor) can activate both MAPK and NF-κB signaling pathways, resulting in the phosphorylation and activation of p38 kinase, ERK1/2, JNK, p65, and AKT, subsequently triggering proinflammatory cytokine production .

The relationship between Lgt-processed lipoproteins and these signaling cascades suggests that Lgt indirectly contributes to N. farcinica's ability to establish infection, particularly in immunocompromised hosts. Lipoproteins processed by Lgt likely participate in adhesion to host cells, invasion mechanisms, and immune evasion strategies, making Lgt an important factor in the pathogenesis of nocardiosis .

What experimental approaches can be used to express recombinant N. farcinica Lgt?

Expression of recombinant N. farcinica Lgt requires thoughtful experimental design due to its membrane-associated nature. The following methodological approach has proven effective:

Expression System Selection:

  • Prokaryotic systems: E. coli BL21(DE3) or similar strains with tightly controlled inducible promoters

  • Expression vectors: pET series vectors containing T7 promoter systems

  • Fusion tags: Addition of His6, GST, or MBP tags to facilitate purification and potentially enhance solubility

Optimization Protocol:

  • Clone the N. farcinica lgt gene into an appropriate expression vector

  • Transform the construct into a suitable E. coli expression strain

  • Optimize expression conditions (temperature, IPTG concentration, induction time)

  • Test small-scale expressions at different temperatures (18°C, 25°C, 37°C)

  • Analyze protein expression by SDS-PAGE and Western blotting

Lower temperatures (18-25°C) often yield better results for membrane proteins like Lgt, as they reduce inclusion body formation and improve proper folding . The addition of specific detergents during cell lysis and purification is essential for maintaining protein stability and functionality.

What are the structural characteristics of Lgt proteins across bacterial species?

Lgt proteins across bacterial species share conserved structural features while exhibiting species-specific variations. Based on the crystal structure of E. coli Lgt (the most well-characterized Lgt protein), the following structural elements can be identified:

Conserved Structural Features:

  • Multiple transmembrane helices that anchor the protein in the bacterial membrane

  • Two substrate binding sites accommodating phosphatidylglycerol and the target prolipoprotein

  • Critical arginine residues (such as Arg143 and Arg239 in E. coli) that are essential for diacylglyceryl transfer activity

The E. coli Lgt structure was solved at 1.9 Å resolution in complex with phosphatidylglycerol and at 1.6 Å resolution with the inhibitor palmitic acid . While the specific structure of N. farcinica Lgt has not been fully elucidated, structural predictions based on homology modeling can provide insights into its potential conformation and functional domains.

Comparative structural analysis between N. farcinica Lgt and its counterparts in other bacterial species could reveal unique features that might be exploited for species-specific inhibitor design.

What methodologies can be employed to assess Lgt enzymatic activity in vitro?

Assessing the enzymatic activity of recombinant N. farcinica Lgt requires specialized techniques that account for its membrane association and lipid substrate requirements. The following methodological approaches can be employed:

GFP-Based In Vitro Assay:
This assay leverages fluorescence to monitor the transfer of the diacylglyceryl group to a substrate. The protocol involves:

  • Preparation of liposomes containing phosphatidylglycerol (substrate)

  • Creation of a fluorescently labeled peptide containing the lipobox motif

  • Incubation of purified recombinant Lgt with the substrate and peptide

  • Detection of lipid transfer by changes in fluorescence properties or mobility shift on gels

Radioactive Assay:
This traditional approach uses radiolabeled phosphatidylglycerol to track the transfer of the diacylglyceryl group:

  • Prepare [14C] or [3H]-labeled phosphatidylglycerol

  • Incubate with purified Lgt and synthetic lipobox-containing peptide

  • Extract lipids and separate by thin-layer chromatography

  • Quantify radioactivity in the lipid-modified peptide fraction

These methodologies enable quantitative assessment of Lgt activity, facilitating structure-function studies and inhibitor screening efforts.

How do Lgt inhibitors affect Nocardia farcinica viability and virulence?

Lgt inhibitors represent potential therapeutic agents against N. farcinica infections. The impact of these inhibitors on bacterial viability and virulence can be assessed through a multi-tiered experimental approach:

Viability Assessment Protocol:

  • Determine minimal inhibitory concentrations (MICs) of candidate Lgt inhibitors against N. farcinica using standard broth microdilution methods

  • Perform time-kill assays to characterize bacteriostatic versus bactericidal effects

  • Evaluate synergy with established antimicrobials using checkerboard assays

  • Assess resistance development through serial passage experiments

Virulence Modulation Analysis:

  • Measure the effect of sub-MIC inhibitor concentrations on N. farcinica invasion of mammalian cells (e.g., HeLa or macrophage cell lines)

  • Quantify changes in proinflammatory cytokine production by host cells upon exposure to inhibitor-treated bacteria

  • Analyze alterations in MAPK and NF-κB signaling pathway activation in host cells

  • Evaluate efficacy in murine models of N. farcinica infection

An effective Lgt inhibitor would ideally reduce both bacterial viability and virulence factor expression, providing dual mechanisms for controlling N. farcinica infections, particularly in immunocompromised patients who are most susceptible to disseminated nocardiosis .

What is the molecular mechanism of Lgt-mediated lipid transfer in Nocardia species?

The molecular mechanism of Lgt-mediated lipid transfer in Nocardia species involves a complex series of substrate recognition and catalytic events. Based on structural and biochemical studies of Lgt in other bacteria, the following mechanism can be proposed:

Sequential Steps in Lgt Catalysis:

  • Binding of phosphatidylglycerol to a specific lipid-binding pocket within Lgt

  • Recognition of the conserved lipobox motif in the preprolipoprotein substrate

  • Positioning of the cysteine sulfhydryl group for nucleophilic attack on the phosphatidylglycerol

  • Transfer of the diacylglyceryl moiety to the cysteine residue

  • Release of the modified prolipoprotein and glycerol-1-phosphate by-product

StepKey ResiduesFunction
Phosphatidylglycerol bindingArginine residues (e.g., Arg143)Interaction with phosphate group
Substrate recognitionHydrophobic pocket residuesRecognition of lipobox motif
CatalysisConserved active site residuesFacilitation of nucleophilic attack
Product releaseMembrane interface residuesLateral release of modified lipoprotein

Critical catalytic residues identified in E. coli Lgt, such as Arg143 and Arg239, are likely conserved in N. farcinica Lgt and play essential roles in diacylglyceryl transfer . Complementation studies with different mutant Lgt variants have revealed these residues to be crucial for enzyme function.

How do host-pathogen interactions influence Lgt expression and activity during N. farcinica infection?

Host-pathogen interactions significantly modulate Lgt expression and activity during N. farcinica infection through various regulatory mechanisms:

Host Environmental Cues Affecting Lgt:

  • pH changes: Lysosomal acidification in phagocytes may alter Lgt expression

  • Nutrient availability: Lipid availability in host environments influences substrate accessibility

  • Immune factors: Host antimicrobial peptides may induce stress responses affecting Lgt regulation

  • Oxygen tension: Varying oxygen levels in different host niches may regulate Lgt expression

Experimental Approaches to Study These Interactions:

  • Transcriptomic analysis of N. farcinica during infection of macrophages or other relevant cell types

  • Proteomic profiling to quantify Lgt protein levels under different infection conditions

  • Reporter gene constructs to monitor Lgt promoter activity in response to host factors

  • Deletion or conditional expression of Lgt to assess impact on bacterial survival in various host environments

During infection, N. farcinica likely modulates Lgt expression to optimize lipoprotein processing for efficient invasion and immune evasion. For instance, proper lipid modification of proteins like Nfa34810 is crucial for facilitating bacterial uptake into host cells and activating signaling pathways that may benefit the pathogen .

What are the genetic and evolutionary characteristics of the lgt gene in Nocardia species compared to other actinobacteria?

The genetic and evolutionary characteristics of the lgt gene in Nocardia species reveal important insights about bacterial adaptation and pathogenicity:

Comparative Genomic Analysis:

SpeciesGene Length (bp)GC Content (%)Conserved DomainsGenetic Context
N. farcinica~1200 (estimated)65-70 (typical range)PLD-like superfamilyAdjacent to lipoprotein processing genes
Other ActinobacteriaVariable55-75PLD-like superfamilySimilar genomic neighborhood
E. coli (reference)1098~50PLD-like superfamilyPart of lipoprotein processing operon

Evolutionary Considerations:

  • Selective pressure: The lgt gene likely experiences purifying selection due to its essential role in most bacteria

  • Horizontal gene transfer: Limited evidence suggests HGT plays a minor role in lgt evolution compared to vertical inheritance

  • Sequence conservation: Catalytic residues show high conservation across diverse bacterial phyla

  • Structural adaptation: Membrane-spanning regions may show adaptations to different membrane compositions

What purification strategies are most effective for recombinant N. farcinica Lgt?

Purifying recombinant N. farcinica Lgt presents significant challenges due to its hydrophobic nature and membrane association. The following comprehensive purification strategy maximizes yield and maintains protein functionality:

Optimized Purification Protocol:

  • Cell Lysis:

    • Resuspend cells in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol

    • Add protease inhibitors (e.g., PMSF, leupeptin, pepstatin)

    • Disrupt cells by sonication or French press

  • Membrane Fraction Isolation:

    • Centrifuge lysate at 10,000 × g for 20 minutes to remove cell debris

    • Ultracentrifuge supernatant at 100,000 × g for 1 hour to pellet membranes

    • Resuspend membrane pellet in solubilization buffer

  • Protein Solubilization:

    • Screen detergents for optimal solubilization (typically n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at 1-2%)

    • Incubate membrane fraction with selected detergent for 1-2 hours at 4°C with gentle agitation

    • Ultracentrifuge at 100,000 × g for 1 hour to remove insoluble material

  • Affinity Chromatography:

    • Apply solubilized protein to Ni-NTA or similar affinity resin

    • Wash with buffer containing 20-30 mM imidazole and 0.05-0.1% detergent

    • Elute with buffer containing 250-300 mM imidazole

  • Size Exclusion Chromatography:

    • Further purify by gel filtration using Superdex 200 column

    • Analyze fractions by SDS-PAGE and Western blotting

    • Pool fractions containing pure Lgt

Maintaining detergent concentrations above the critical micelle concentration throughout purification is essential for preventing protein aggregation. Stability of the purified protein can be enhanced by addition of specific lipids, particularly phosphatidylglycerol, which serves as a substrate for Lgt .

How can researchers effectively study Lgt-substrate interactions in Nocardia species?

Studying Lgt-substrate interactions in Nocardia species requires specialized techniques that address both the membrane environment and the dual substrate nature of the enzyme. The following methodological approaches provide comprehensive insights:

Substrate Binding Studies:

  • Isothermal Titration Calorimetry (ITC):

    • Prepare purified Lgt in detergent micelles or nanodiscs

    • Titrate with incrementally increasing concentrations of phosphatidylglycerol or synthetic lipobox peptides

    • Analyze thermodynamic parameters (ΔH, ΔS, Kd) of binding events

  • Microscale Thermophoresis (MST):

    • Fluorescently label purified Lgt

    • Titrate with increasing concentrations of substrate

    • Measure changes in thermophoretic mobility to determine binding affinities

Structure-Based Approaches:

  • X-ray Crystallography:

    • Crystallize Lgt in complex with substrate analogs or inhibitors

    • Collect diffraction data at synchrotron radiation facilities

    • Determine structure through molecular replacement using E. coli Lgt as a template

  • Cryo-Electron Microscopy:

    • Prepare Lgt in lipid nanodiscs with bound substrates

    • Collect high-resolution images

    • Perform single-particle reconstruction to visualize enzyme-substrate complexes

  • Molecular Docking and Simulation:

    • Generate homology models of N. farcinica Lgt based on the E. coli structure

    • Dock phosphatidylglycerol and lipobox peptides into the active site

    • Perform molecular dynamics simulations to analyze binding stability and conformational changes

These approaches collectively provide a comprehensive understanding of how Lgt recognizes and processes its substrates, potentially revealing species-specific features that could be exploited for therapeutic development.

What mutational analysis strategies can reveal functional domains in N. farcinica Lgt?

Systematic mutational analysis can uncover critical functional domains and residues in N. farcinica Lgt. The following comprehensive approach provides maximum insight:

Site-Directed Mutagenesis Strategy:

  • Target Selection:

    • Conserved residues identified through multiple sequence alignment

    • Predicted catalytic residues (homologous to E. coli Arg143 and Arg239)

    • Membrane-spanning domains and substrate-binding regions

    • Surface-exposed loops potentially involved in protein-protein interactions

  • Mutation Types:

    • Alanine scanning: Replace selected residues with alanine to remove side chain functionality

    • Conservative substitutions: Replace residues with chemically similar amino acids

    • Charge reversal: Convert positive residues to negative and vice versa

    • Domain swapping: Replace entire domains with corresponding regions from other species

Functional Analysis Protocol:

  • Express wild-type and mutant proteins in parallel

  • Assess protein expression and stability by Western blotting

  • Purify proteins using identical protocols

  • Compare enzymatic activities using standardized assays

  • Perform complementation studies in lgt-deficient bacterial strains

Data Interpretation Framework:

  • Residues essential for catalysis: Mutations cause complete loss of activity

  • Residues involved in substrate binding: Mutations alter substrate affinity (Km)

  • Residues affecting structural integrity: Mutations reduce protein stability

  • Species-specific residues: Mutations affect activity differently in N. farcinica compared to other bacteria

This systematic approach can generate a comprehensive functional map of N. farcinica Lgt, highlighting residues that might serve as targets for specific inhibitor design.

How can recombinant N. farcinica Lgt be utilized for developing diagnostic tools for nocardiosis?

Recombinant N. farcinica Lgt offers significant potential for developing advanced diagnostic tools for nocardiosis, particularly for immunocompromised patients where early detection is crucial. The following methodological approaches leverage this protein for diagnostic applications:

Serological Diagnostic Strategies:

  • ELISA-Based Detection:

    • Coat microplates with purified recombinant Lgt

    • Incubate with patient serum samples

    • Detect bound antibodies using enzyme-conjugated secondary antibodies

    • Establish sensitivity and specificity thresholds through ROC curve analysis

  • Lateral Flow Immunoassay:

    • Immobilize recombinant Lgt on nitrocellulose membranes

    • Apply patient samples followed by labeled detection antibodies

    • Develop rapid point-of-care tests for resource-limited settings

Performance Optimization Parameters:

  • Sensitivity enhancement through signal amplification techniques

  • Cross-reactivity elimination through comparative testing with related bacterial antigens

  • Validation using diverse patient cohorts, particularly immunocompromised individuals

Nocardiosis is often missed in the event of concomitant occurrence of more prevalent chronic infectious diseases such as tuberculosis, especially in developing countries like India . Lgt-based diagnostics could significantly improve detection specificity, as properly designed assays would distinguish between Nocardia and other acid-fast bacilli, potentially reducing misdiagnosis.

What are the potential challenges in developing inhibitors targeting N. farcinica Lgt?

Developing effective inhibitors targeting N. farcinica Lgt presents several methodological challenges that must be systematically addressed:

Key Challenges and Mitigation Strategies:

ChallengeDescriptionMitigation Strategy
Membrane localizationLgt is embedded in the cytoplasmic membrane, making it less accessible to inhibitorsDesign lipophilic compounds or prodrugs that can penetrate bacterial membranes effectively
SelectivityEnsuring inhibitors target N. farcinica Lgt without affecting human enzymesFocus on structural differences between bacterial and human enzymes; conduct extensive counter-screening
Structural complexityLimited structural information specific to N. farcinica LgtUtilize homology modeling based on E. coli Lgt crystal structures; validate models experimentally
Resistance developmentPotential mutations in Lgt that confer resistanceDesign inhibitors targeting highly conserved, functionally essential residues
Delivery to infection sitesN. farcinica can cause disseminated infections in multiple organsDevelop formulations with appropriate pharmacokinetic properties for target tissue distribution

Screening Approaches:

  • Structure-based virtual screening:

    • Generate homology models of N. farcinica Lgt

    • Perform in silico docking of compound libraries

    • Rank compounds based on predicted binding energy and interactions with key residues

  • High-throughput biochemical screening:

    • Establish robust in vitro assays for Lgt activity

    • Screen diverse chemical libraries

    • Validate hits through secondary assays and structure-activity relationship studies

The development of Lgt inhibitors represents a promising approach for treating nocardiosis, particularly for disseminated infections that involve multiple sites (lungs, brain, subcutaneous tissue/lymphatics) and affect immunocompromised patients .

How does N. farcinica Lgt compare functionally with Lgt proteins in other pathogenic bacteria?

Comparative analysis of N. farcinica Lgt with its counterparts in other pathogenic bacteria reveals important functional similarities and differences that impact pathogenesis and potential therapeutic approaches:

Functional Comparison Across Bacterial Species:

SpeciesLgt EssentialitySubstrate SpecificityRole in VirulenceInhibitor Sensitivity
N. farcinicaLikely non-essentialNot fully characterizedContributes to invasion and immune modulationUnknown
E. coliEssentialWell-characterizedImportant for membrane integritySensitive to specific inhibitors
Corynebacterium glutamicumNon-essentialCharacterizedInvolved in cell envelope maintenancePartially characterized
Mycobacterium tuberculosisEssentialPartially characterizedCritical for pathogenesisPotential drug target

Key Differences and Their Significance:

  • While lgt is essential in most Gram-negative bacteria like E. coli , its essentiality in Nocardia species may follow patterns similar to other Actinobacteria like Corynebacterium, where it may be non-essential under certain conditions .

  • Species-specific differences in substrate recognition could be exploited for selective inhibitor design, targeting N. farcinica Lgt without affecting commensal bacteria.

  • The contribution of Lgt to virulence varies across species, with N. farcinica potentially using Lgt-processed lipoproteins like Nfa34810 to modulate host immune responses and facilitate invasion .

These comparative insights provide a foundation for understanding N. farcinica Lgt's unique properties and its potential as a therapeutic target for treating nocardiosis, particularly in immunocompromised patients who are at higher risk for disseminated infections .

What emerging technologies hold promise for advanced characterization of N. farcinica Lgt?

Several cutting-edge technologies show exceptional promise for advancing our understanding of N. farcinica Lgt structure, function, and role in pathogenesis:

Emerging Methodological Approaches:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of membrane proteins in near-native environments

    • Allows study of Lgt in lipid nanodiscs or native membrane environments

    • Can potentially reveal conformational changes during catalysis

    • Resolution capabilities approaching 2-3 Å for membrane proteins

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry):

    • Maps protein dynamics and conformational changes upon substrate binding

    • Identifies regions of Lgt that interact with phosphatidylglycerol and prolipoproteins

    • Requires minimal protein amounts compared to structural techniques

  • AlphaFold2 and Structure Prediction:

    • Generates highly accurate protein structure predictions

    • Can model N. farcinica Lgt structure even with limited experimental data

    • Facilitates rational inhibitor design and functional predictions

  • Single-Molecule FRET:

    • Observes individual enzyme molecules during catalysis

    • Reveals transient conformational states not captured by ensemble methods

    • Provides insights into the dynamics of substrate recognition and product release

  • Native Mass Spectrometry:

    • Analyzes intact membrane protein complexes

    • Determines lipid binding preferences and stoichiometry

    • Identifies potential interaction partners of Lgt in the bacterial membrane

These technologies collectively promise to overcome traditional barriers to studying membrane proteins like Lgt, potentially revealing novel aspects of its function that could be exploited for therapeutic intervention against N. farcinica infections.

How might systems biology approaches enhance our understanding of Lgt's role in N. farcinica pathogenesis?

Systems biology approaches offer powerful frameworks for comprehensively understanding Lgt's role within the broader context of N. farcinica pathogenesis:

Integrated Systems Approaches:

The integration of these approaches could reveal how Lgt activity influences N. farcinica's ability to establish disseminated infections in diverse host tissues including lungs, brain, and subcutaneous tissues/lymphatics, particularly in immunocompromised patients such as those with SLE on immunosuppressive therapy .

This systems-level understanding could lead to more effective therapeutic strategies that target not only Lgt itself but also critical nodes in the host-pathogen interaction network affected by Lgt activity.

What interdisciplinary research collaborations would advance N. farcinica Lgt research most effectively?

Advancing research on N. farcinica Lgt requires strategic interdisciplinary collaborations that combine diverse expertise to address complex challenges:

Key Collaborative Research Frameworks:

  • Structural Biology and Medicinal Chemistry:

    • Determine high-resolution structures of N. farcinica Lgt

    • Design and synthesize potential inhibitors based on structural insights

    • Optimize lead compounds through iterative structure-activity relationship studies

    • Develop structure-based pharmacophore models specific to N. farcinica Lgt

  • Clinical Microbiology and Immunology:

    • Collect clinical isolates of N. farcinica from diverse geographic locations

    • Characterize genetic diversity in lgt genes across clinical strains

    • Assess immune responses to Lgt-processed lipoproteins in patient samples

    • Correlate Lgt variants with disease presentation and outcomes

  • Bioinformatics and Evolutionary Biology:

    • Apply phylogenomic approaches to understand Lgt evolution in Nocardia species

    • Identify genetic elements influencing lgt expression and regulation

    • Predict functional consequences of natural variations in Lgt sequences

    • Address the epistemic challenges in phylogenetic reconstructions that have resulted in divergent evolutionary hypotheses

  • Pharmaceutical Sciences and Nanotechnology:

    • Develop delivery systems for Lgt inhibitors that can penetrate bacterial cell walls

    • Design nanoparticle formulations targeting infected tissues

    • Optimize pharmacokinetic properties for treatment of disseminated nocardiosis

    • Explore combination therapies with established antimicrobials

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.