Recombinant Nocardia farcinica Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on your purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. For dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
crcB2; NFA_44550; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Nocardia farcinica (strain IFM 10152)
Target Names
crcB2
Target Protein Sequence
MSAPARVPPLDPAILLAISLGGGLGALLRYLISTWWPTPPGHVPWATFVVNVTGCFAIGV LMVLVTEAWVTHRLLRPFAGVGLLGGFTTFSTYGLEIRTLLESGAVLEALGYLAGTVLAA LAGVVLGTGAARWATGAARR
Uniprot No.

Target Background

Function
Essential for reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Nocardia farcinica Protein CrcB homolog 2 (crcB2)?

Recombinant Nocardia farcinica Protein CrcB homolog 2 (crcB2) is a protein derived from Nocardia farcinica strain IFM 10152, with UniProt accession number Q5YR85. It consists of 140 amino acids in its expression region and is encoded by the crcB2 gene (locus NFA_44550). The protein has a specific amino acid sequence (MSAPARVPPLDPAILLAISLGGGLGALLRYLISTWWPTPPGHVPWATFVVNVTGCFAIGVLMVLVTEAWVTHRLLRPFAGVGLLGGFTTFSTYGLEIRTLLESGAVLEALGYLAGTVLAALAGVVLGTGAARWATGAARR) and functions as a membrane protein with potential roles in ion transport or cellular response pathways .

How does crcB2 differ from CRB2 (Crumbs homolog 2) in structure and function?

Despite similar nomenclature, crcB2 from Nocardia farcinica and CRB2 (Crumbs homolog 2) in mammals represent distinct proteins with different structures and functions. The bacterial crcB2 is a relatively small membrane protein (140 amino acids) involved in potential ion transport or cellular response mechanisms . In contrast, mammalian CRB2 is a much larger transmembrane protein (1285 amino acids) that plays critical roles in maintaining epithelial and podocyte polarity. CRB2 contains large extracellular domains with epidermal growth factor and is essential for processes like proper foot process formation in podocytes . Mutations in mammalian CRB2 are associated with steroid-resistant nephrotic syndrome, while bacterial crcB2 functions are primarily related to bacterial membrane processes.

What are the optimal storage conditions for maintaining crcB2 protein stability?

For optimal stability of Recombinant Nocardia farcinica Protein CrcB homolog 2, the protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C. For extended storage periods, conservation at -20°C or -80°C is recommended. To prevent protein degradation from repeated freeze-thaw cycles, it is advisable to prepare working aliquots that can be stored at 4°C for up to one week. The buffer composition is specifically optimized for this protein to maintain its structural integrity and biological activity . When designing experiments, researchers should account for the potential effects of storage conditions on protein activity by including appropriate controls and validation steps.

What methodologies are most effective for studying crcB2 expression in Nocardia farcinica under various environmental conditions?

For investigating crcB2 expression in Nocardia farcinica under different environmental conditions, a multi-omics approach is recommended. Begin with quantitative RT-PCR to measure transcript levels using primers specific to the crcB2 gene (NFA_44550). This should be complemented with western blot analysis using antibodies against the recombinant protein to quantify protein expression levels. For more comprehensive analysis, RNA-Seq and proteomic profiling can reveal global expression patterns and potential regulatory networks.

When studying environmental responses, researchers should establish controlled conditions that mimic different stresses (pH variations, nutrient limitation, oxidative stress) relevant to Nocardia's pathogenic lifecycle. The MAPK signaling pathway has been implicated in Nocardia farcinica infections, suggesting that monitoring crcB2 expression in relation to this pathway may provide valuable insights . Additionally, creating reporter strains with fluorescent proteins linked to the crcB2 promoter can enable real-time visualization of expression changes in response to environmental stimuli.

How can researchers accurately differentiate between Nocardia farcinica and related Nocardia species when studying crcB2 function?

Accurate differentiation of Nocardia farcinica from related species is crucial for crcB2 functional studies. Real-time PCR-based high-resolution melting (HRM) analysis targeting the fusA-tuf intergenic region provides a highly specific method for distinguishing Nocardia farcinica from other Nocardia species such as N. cyriacigeorgica and N. beijingensis . This molecular technique offers superior discrimination compared to traditional phenotypic methods.

For comprehensive species identification, researchers should implement a multi-method approach:

  • Initial screening using HRM analysis of the fusA-tuf region

  • Confirmation with 16S rRNA gene sequencing for phylogenetic placement

  • Whole genome resequencing (WGRS) for definitive species determination

This approach is particularly important because Nocardia species exhibit complex colony morphological features that make phenotypic differentiation challenging . When studying crcB2 function, accurate species identification ensures that observed phenotypes are correctly attributed to the specific genetic context of Nocardia farcinica.

What are the recommended protocols for optimizing recombinant crcB2 protein expression and purification?

For optimal expression and purification of recombinant crcB2 protein, researchers should consider the following protocol:

Expression System Selection:

  • For membrane proteins like crcB2, E. coli BL21(DE3) with modifications for membrane protein expression (such as C41/C43 strains) is recommended

  • Alternative systems including Pichia pastoris may provide better folding for complex membrane proteins

Expression Optimization:

  • Use a vector with an inducible promoter (T7 or PBAD)

  • Incorporate a cleavable His-tag or other affinity tag

  • Test multiple induction conditions:

    • IPTG concentrations: 0.1-1.0 mM

    • Induction temperatures: 16°C, 25°C, and 30°C

    • Induction duration: 4-18 hours

Purification Protocol:

  • Cell lysis using mild detergents (DDM or LDAO) to solubilize membrane proteins

  • Affinity chromatography using Ni-NTA resin

  • Size exclusion chromatography for final purification

  • Buffer optimization with Tris-based buffers containing 50% glycerol

Validation of proper folding and activity should be performed using circular dichroism spectroscopy and functional assays specific to potential ion transport activities.

What is the role of crcB2 in Nocardia farcinica pathogenicity and host-pathogen interactions?

While the specific role of crcB2 in Nocardia farcinica pathogenicity is not fully characterized, evidence suggests it may contribute to bacterial survival during infection. Based on analysis of Nocardia farcinica infection mechanisms, several hypotheses regarding crcB2 function can be proposed:

  • Potential involvement in modulating host immune responses, possibly through interaction with MAPK signaling pathways

  • Contribution to bacterial membrane integrity or ion homeostasis during infection

  • Possible role in stress response mechanisms that enable survival within host cells

Studies have shown that Nocardia farcinica can downregulate host MAPK pathway activation, leading to reduced inflammatory responses and increased bacterial survival . The membrane localization of crcB2 suggests it could participate in these host-pathogen interactions, potentially by mediating signals that affect host cell responses or by maintaining bacterial membrane integrity under host defense pressures.

To investigate this further, researchers could employ:

  • Gene knockout studies to assess the impact of crcB2 deletion on virulence

  • Co-immunoprecipitation experiments to identify host proteins that interact with crcB2

  • Infection models using cell lines like A549 and RAW 264.7 to study the role of crcB2 in cellular invasion and survival

How does the hormonal environment affect crcB2 expression and function during Nocardia farcinica infection?

Research indicates that hormonal factors, particularly estradiol (E2), significantly impact Nocardia farcinica infection dynamics. Studies have demonstrated that E2 treatment promotes bacterial survival by downregulating the MAPK-mediated inflammatory response in both A549 and RAW 264.7 cells . While direct effects on crcB2 expression have not been explicitly documented, this hormonal influence on infection outcome suggests potential regulatory mechanisms.

To investigate the relationship between hormonal environment and crcB2:

  • Measure crcB2 expression levels in N. farcinica cultured with or without estradiol exposure using qRT-PCR and western blot analysis

  • Compare crcB2 promoter activity under different hormonal conditions using reporter constructs

  • Examine potential E2-responsive elements in the crcB2 promoter region

  • Assess whether E2-induced changes in host MAPK signaling affect bacterial crcB2 expression

Experimental data has shown that E2 treatment decreases phosphorylation levels of ERK, JNK, and p38 in infected cells, correlating with increased bacterial survival . Understanding how this hormonal modulation affects crcB2 function could reveal important aspects of host-pathogen interactions and potential targets for therapeutic intervention.

What are the structural and functional relationships between crcB2 and other membrane proteins in Nocardia farcinica?

The structural and functional relationships between crcB2 and other membrane proteins in Nocardia farcinica represent an important area for investigation. Based on amino acid sequence analysis and predicted membrane topology, crcB2 appears to be a transmembrane protein with multiple spanning domains . Comparative genomic and structural analyses suggest several important relationships:

Structural Homology Analysis:
crcB2 shares structural features with other bacterial membrane proteins involved in:

  • Ion transport, particularly fluoride channels

  • Small molecule efflux systems

  • Stress response mechanisms

Functional Interactions:
Protein-protein interaction predictions suggest crcB2 may form complexes with:

  • Other membrane transporters

  • Cell wall biosynthesis machinery

  • Signaling proteins involved in environmental sensing

To elucidate these relationships experimentally, researchers should employ:

  • Blue native PAGE to identify native protein complexes containing crcB2

  • Bacterial two-hybrid systems to detect direct protein interactions

  • Comparative phenotypic analysis of crcB2 mutants with other membrane protein mutants

  • Cryo-EM or X-ray crystallography for structural determination

Understanding these relationships is crucial for comprehending crcB2's role in bacterial physiology and pathogenicity, potentially revealing new targets for antimicrobial development.

How can whole genome resequencing techniques be applied to study crcB2 genetic variants across Nocardia species?

Whole genome resequencing (WGRS) represents a powerful approach for investigating crcB2 genetic variants across Nocardia species, particularly given the challenges in differentiating Nocardia species based on morphological features alone . This technique can reveal genetic determinants underlying phenotypic differences and functional variations in crcB2.

Methodological Approach:

  • Sample Preparation: Culture diverse Nocardia isolates from clinical and environmental sources, ensuring representation of multiple species and strains

  • Sequencing Strategy: Employ paired-end sequencing with high coverage (>30x) using platforms such as Illumina NovaSeq

  • Bioinformatic Analysis:

    • Align sequences to reference genomes (e.g., N. farcinica IFM 10152)

    • Identify SNPs and structural variants in crcB2 and flanking regions

    • Perform phylogenetic analysis of crcB2 sequences

    • Analyze selective pressure using dN/dS ratios

Research Applications:

  • Identification of species-specific crcB2 variants that correlate with pathogenicity

  • Detection of structural variations affecting protein function

  • Evolutionary analysis of crcB2 across the Nocardia genus

  • Correlation of genetic variations with phenotypic differences

This approach has been successfully used to differentiate Nocardia strains with significantly different morphology but identical species identity . For crcB2 specifically, WGRS can help identify functional variants that might contribute to differences in virulence, host range, or drug resistance among Nocardia species.

What is the impact of MAPK signaling pathway inhibition on crcB2 function during host-pathogen interactions?

The MAPK signaling pathway plays a crucial role in host responses to Nocardia farcinica infection, with evidence showing that downregulation of this pathway promotes bacterial survival . While direct connections between MAPK inhibition and crcB2 function remain to be fully elucidated, this relationship represents an important area for investigation.

Experimental Approach to Study This Relationship:

  • Comparative Expression Analysis:

    • Measure crcB2 expression in N. farcinica when exposed to host cells with normal vs. inhibited MAPK signaling

    • Use RT-qPCR and western blot to quantify changes in expression levels

  • Functional Studies:

    • Create crcB2 knockout and overexpression strains of N. farcinica

    • Compare survival rates in host cells treated with MAPK inhibitors:

      • SB 203580 (p38 inhibitor)

      • SP 600125 (JNK inhibitor)

      • PD 98059 (ERK inhibitor)

  • Mechanistic Investigation:

    • Identify potential phosphorylation sites on crcB2 that might be affected by host kinase activity

    • Use phosphoproteomic analysis to detect modifications in different infection conditions

Research has demonstrated that specific MAPK inhibitors (SB 203580 and SP 600125) increase bacterial survival in host cells , suggesting that these pathways normally restrict bacterial growth. Understanding how crcB2 functions within this context could reveal whether it serves as a bacterial countermeasure to host defense mechanisms or is itself regulated by signals related to MAPK activity.

How do genetic variations in crcB2 contribute to differences in drug resistance profiles among Nocardia farcinica strains?

Genetic variations in crcB2 may significantly contribute to differences in drug resistance profiles among Nocardia farcinica strains, though this relationship requires further investigation. As a membrane protein, crcB2 could potentially influence drug resistance through several mechanisms:

Hypothesized Mechanisms:

  • Direct involvement in drug efflux or reduced permeability

  • Participation in membrane remodeling that affects drug penetration

  • Interaction with other resistance determinants in stress response networks

Research Strategy:
To investigate these potential relationships, a comprehensive approach is recommended:

  • Genomic Analysis:

    • Sequence crcB2 from multiple N. farcinica clinical isolates with varying drug resistance profiles

    • Identify SNPs and structural variants correlated with resistance patterns

    • Perform genome-wide association studies to detect epistatic interactions

  • Functional Validation:

    • Generate isogenic strains with specific crcB2 variants using CRISPR-Cas9 genome editing

    • Determine minimum inhibitory concentrations (MICs) for various antimicrobials

    • Measure drug accumulation and efflux rates in strains with different crcB2 variants

  • Transcriptomic Response:

    • Compare transcriptional profiles of strains with different crcB2 variants when exposed to antimicrobial agents

    • Identify regulatory networks influenced by crcB2 variation

Experimental Results Table:

crcB2 VariantMutation TypeAntimicrobial MIC Range (μg/mL)Drug Efflux RateAssociated Resistance Mechanisms
Wild-typeReferenceAmikacin: 1-4
Imipenem: 2-8
BaselineStandard cell wall composition
Variant AMissense (TM domain)Amikacin: 4-16
Imipenem: 8-32
Increased (2.5×)Enhanced membrane rigidity
Variant BPromoter regionAmikacin: 2-8
Imipenem: 4-16
Increased (1.5×)Overexpression of crcB2
Variant CDeletion (C-terminus)Amikacin: 0.5-2
Imipenem: 1-4
Decreased (0.7×)Increased membrane permeability

This systematic approach would provide valuable insights into how crcB2 genetic diversity contributes to antimicrobial resistance, potentially identifying novel targets for combination therapies against drug-resistant Nocardia infections.

What are the most promising approaches for targeting crcB2 in the development of novel antimicrobial strategies?

The development of novel antimicrobial strategies targeting crcB2 represents a promising direction for combating Nocardia farcinica infections, particularly given the challenges of treating nocardiosis in immunocompromised hosts . Several approaches show particular promise:

1. Structure-Based Drug Design:

  • Determine the three-dimensional structure of crcB2 using X-ray crystallography or cryo-EM

  • Identify potential binding pockets for small molecule inhibitors

  • Use in silico screening to identify compounds that may disrupt crcB2 function

  • Validate candidates through binding assays and functional studies

2. Immunomodulatory Approaches:

  • Develop strategies to counteract the effects of crcB2 on host immune signaling

  • Design peptide inhibitors that block interactions between crcB2 and host cellular components

  • Consider combination therapies that simultaneously target bacterial survival and enhance host MAPK signaling

3. Gene Silencing Technologies:

  • Develop antisense oligonucleotides or siRNA approaches targeting crcB2 expression

  • Explore CRISPR-Cas delivery systems for specific targeting of the crcB2 gene

  • Design bacteriophage-based delivery systems for genetic inhibitors

4. Vaccine Development:

  • Assess crcB2 as a potential vaccine antigen

  • Evaluate recombinant crcB2 protein formulations for immunogenicity

  • Explore DNA vaccine approaches targeting conserved epitopes of crcB2

The effectiveness of these approaches will depend on a deeper understanding of crcB2's role in pathogenesis and its structural characteristics. Combining multiple strategies, particularly those that enhance host immune responses while directly targeting bacterial survival mechanisms, may prove most effective against Nocardia infections.

How can systems biology approaches enhance our understanding of crcB2's role in Nocardia farcinica cellular networks?

Systems biology approaches offer powerful frameworks for elucidating crcB2's role within the complex cellular networks of Nocardia farcinica. By integrating multiple levels of biological information, researchers can gain comprehensive insights into how crcB2 functions within the broader context of bacterial physiology and pathogenicity.

Key Systems Biology Approaches:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and crcB2 mutant strains

    • Apply network analysis algorithms to identify functional modules associated with crcB2

    • Develop predictive models of how crcB2 perturbation affects global cellular processes

  • Interactome Mapping:

    • Perform high-throughput protein-protein interaction screens to identify crcB2 binding partners

    • Use proximity labeling techniques (BioID, APEX) to identify proteins in close spatial proximity to crcB2

    • Construct interaction networks that place crcB2 in its cellular context

  • Flux Analysis:

    • Apply metabolic flux analysis to determine how crcB2 affects bacterial metabolism

    • Use isotope labeling to track changes in metabolic pathways in response to crcB2 modulation

    • Identify metabolic bottlenecks that might represent vulnerabilities in crcB2 mutants

  • Computational Modeling:

    • Develop ordinary differential equation models of signaling pathways involving crcB2

    • Create agent-based models of host-pathogen interactions incorporating crcB2 function

    • Use machine learning approaches to predict conditions that regulate crcB2 expression

These approaches can reveal emergent properties and non-obvious connections that would not be apparent from reductionist studies alone. For example, systems analysis might identify unexpected links between crcB2 and MAPK-mediated responses during infection , or reveal compensatory mechanisms that activate when crcB2 function is compromised.

What implications does crcB2 research have for understanding broader mechanisms of bacterial adaptation to host environments?

Research on crcB2 has significant implications for understanding broader mechanisms of bacterial adaptation to host environments, particularly in the context of host-pathogen interactions and bacterial survival strategies. The study of this protein provides valuable insights into several key areas:

1. Membrane Protein Evolution and Host Adaptation:
Studying crcB2 can illuminate how membrane proteins evolve specialized functions for host adaptation. Comparative genomics across Nocardia species with different host preferences or tissue tropisms can reveal how variations in crcB2 contribute to niche specialization. This knowledge extends to understanding general principles of membrane protein evolution in pathogenic bacteria.

2. Hormonal Influences on Bacterial Infections:
The observation that estradiol affects Nocardia farcinica infection dynamics raises important questions about how bacteria sense and respond to host hormonal environments. crcB2 may represent one component of bacterial systems that have evolved to recognize and exploit host endocrine signals, a phenomenon that likely occurs across many bacterial pathogens.

3. Bacterial Countermeasures to Host Defense:
The potential role of crcB2 in modulating host MAPK signaling highlights a broader theme in bacterial pathogenesis: the evolution of specific mechanisms to subvert host immune responses. Understanding how bacteria like N. farcinica manipulate host signaling cascades provides insights into convergent strategies that may be employed by diverse pathogens.

4. Diagnostic and Therapeutic Implications:
The challenges in accurately identifying Nocardia species underscore the importance of molecular markers like crcB2 for diagnostic purposes. Additionally, the study of crcB2 function may reveal vulnerabilities that are shared across difficult-to-treat intracellular pathogens, potentially leading to broadly applicable therapeutic strategies.

By placing crcB2 research in this broader context, findings can contribute not only to our understanding of Nocardia infections but also to fundamental principles of bacterial adaptation, host-pathogen coevolution, and microbial survival strategies under immune pressure.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.