Recombinant Nocardia farcinica Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Role in Bacterial Physiology

uppP is a membrane-bound hydrolase (EC 3.6.1.27) that facilitates the recycling of UPP in bacterial cell wall synthesis. It operates in a cycle where UP is phosphorylated to UPP during the transport of peptidoglycan precursors across the cytoplasmic membrane. Subsequent dephosphorylation by uppP regenerates UP for reuse .

Key Functions:

  • Peptidoglycan Synthesis: Converts UPP to UP, enabling the lipid carrier to transport N-acetylmuramic acid-N-acetylglucosamine precursors .

  • Lipopolysaccharide Assembly: Supports the translocation of O-antigen subunits in Gram-negative bacteria .

  • Antibiotic Resistance: Overexpression of uppP can confer bacitracin resistance by counteracting bacitracin’s inhibition of UPP dephosphorylation .

Recombinant Production and Applications

Recombinant uppP is synthesized in heterologous systems (e.g., yeast) for biochemical and structural studies.

Production Details:

ParameterSpecificationSource
Host OrganismYeast
Purity>85% (SDS-PAGE)
Storage BufferTris-based, 50% glycerol
Stability6 months at -20°C/-80°C (liquid)

Key Applications:

  • Antibiotic Target Validation: Testing inhibitors of peptidoglycan synthesis.

  • Structural Studies: X-ray crystallography to map active-site interactions .

  • Mechanistic Insights: Mutagenesis to identify residues critical for catalysis .

Functional Redundancy and Antibiotic Resistance

In Bacillus subtilis, uppP and BcrC are functionally redundant UPP phosphatases. Depletion of both enzymes leads to cell lysis and activation of the σᴹ stress response, highlighting their essential role in cell wall integrity . Similarly, N. farcinica may employ uppP to counteract bacitracin by regenerating UP despite antibiotic-mediated UPP sequestration .

Comparative Analysis of UPP Phosphatases

The following table contrasts N. farcinica uppP with homologs in other pathogens:

OrganismEnzymeKey Features
N. farcinicauppP (Q5YVL4)Bacitracin resistance, periplasmic activity
E. coliUppP (P60933)Membrane-bound, His30/Arg174 critical residues
B. subtilisUppP/BcrCRedundant, σᴹ-dependent stress response

Challenges and Future Directions

  • Structural Elucidation: High-resolution crystal structures of N. farcinica uppP remain lacking.

  • In Vivo Validation: Testing recombinant uppP’s role in N. farcinica pathogenicity models.

  • Antibiotic Synergy: Exploring combinations targeting uppP and other cell wall enzymes.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your unique needs. Please specify any format preference when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol includes 50% glycerol. You may adjust this according to your specific requirements.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We prioritize producing the protein with the specified tag type if you have a preference. Please communicate your needs, and we will endeavor to meet them.
Synonyms
uppP; NFA_29300; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Nocardia farcinica (strain IFM 10152)
Target Names
uppP
Target Protein Sequence
MGESMTWVQALVLGLVQGLTEFLPISSSAHLRIVSSVFFGEDAGASFTAVTQLGTEAAVL VYFAKDIWRILVAWTTTLWDKARAATGPRVPIHDRPTTRLPVLTADNEHRFAAEAQRELD YRIGWYVIIATIPIGVLGFLFKDEIRTGARNLWLVSFMLIAFALVIAAAEHYGAKRRPIE QLTTRDGLVMGFAQCLALIPGVSRSGATSSAGLFLGLEREAAVRFSFLLAIPAVTASGLF SLPDAFEPAGEGLNASGPQLLVATIVSFVVGYASVAWLLKFVARHSLNWFVGYRIVLGLV IMGLLGAGVISAT
Uniprot No.

Target Background

Function
Recombinant Nocardia farcinica Undecaprenyl-diphosphatase (uppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). This enzyme plays a crucial role in conferring resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Nocardia farcinica Undecaprenyl-diphosphatase (uppP)?

Nocardia farcinica Undecaprenyl-diphosphatase (uppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) . This enzymatic activity is crucial for the lipid II cycle of cell wall biosynthesis, as it enables the recycling of the carrier molecule undecaprenyl phosphate (UP). During cell wall synthesis, building blocks are assembled inside the cytoplasm and transported to the outside for incorporation into the cell wall. After this process, the carrier molecule must be recycled through dephosphorylation from UPP to UP . This recycling step is indispensable for maintaining cell wall integrity and continued bacterial growth.

What is the subcellular localization and structure of uppP in Nocardia farcinica?

Undecaprenyl-diphosphatase is a multi-pass membrane protein localized in the cell membrane of Nocardia farcinica . The full-length protein consists of 313 amino acids. Its transmembrane nature is consistent with its function in processing membrane-associated undecaprenyl diphosphate. The protein belongs to the UppP family, a group of enzymes conserved across various bacterial species that participate in cell envelope biosynthesis . The multi-pass transmembrane structure allows the enzyme to interact with its substrate in the membrane environment where the lipid II cycle components are processed.

What expression systems are optimal for producing recombinant Nocardia farcinica uppP?

The most effective system reported for expression of recombinant Nocardia farcinica uppP is an in vitro E. coli expression system . When designing an expression protocol, researchers should consider the following methodological approaches:

  • Using an N-terminal 10xHis-tag for purification purposes

  • Expressing the full-length protein (amino acids 1-313)

  • Utilizing Tris/PBS-based buffer systems with pH 8.0

  • Including 6% Trehalose as a stabilizing agent

This approach yields functional recombinant protein suitable for enzymatic studies. When selecting between liquid and lyophilized forms, consider the specific experimental requirements. Lyophilized protein shows better stability with a shelf life of approximately 12 months at -20°C/-80°C, compared to 6 months for the liquid form .

What are the optimal storage conditions for maintaining recombinant uppP activity?

To maintain optimal activity of recombinant Nocardia farcinica uppP, store the protein at -20°C/-80°C and avoid repeated freeze-thaw cycles by preparing aliquots for multiple use . The shelf life varies depending on the preparation format:

Preparation FormatStorage TemperatureApproximate Shelf Life
Liquid form-20°C/-80°C6 months
Lyophilized form-20°C/-80°C12 months

Several factors affect enzyme stability, including buffer composition, storage temperature, and the inherent stability of the protein itself. For long-term studies, the lyophilized preparation with 6% Trehalose provides better stability. When reconstituting the lyophilized protein, use the original buffer system (Tris/PBS-based buffer, pH 8.0) to maintain native conformation and activity .

What PCR-based methods can be used to identify and study Nocardia farcinica uppP?

A highly specific PCR assay has been developed for the rapid identification of Nocardia farcinica, which can be adapted to study the uppP gene . The methodological approach involves:

  • Design of specific primer pairs complementary to N. farcinica-specific sequences

  • PCR amplification of genomic DNA to generate a specific fragment

  • Verification of specificity through restriction enzyme digestion and direct sequencing

  • Differentiation from heterologous nocardial species and other related bacterial genera

The Nf1 (5′-CCGCAGACCACGCAAC) and Nf2 (5′-ACGAGGTGACGGCTGC) primer pair has been validated for specific identification of N. farcinica . This PCR assay allows for rapid identification (within 1 day of obtaining DNA) of this medically important pathogen, which is significantly faster than traditional phenotypic characterization methods that can take up to 3 weeks. The approach shows high sensitivity and specificity with no cross-reactivity observed with other Nocardia species or related bacterial genera .

How can researchers effectively measure uppP enzymatic activity in vitro?

To effectively measure Nocardia farcinica uppP enzymatic activity in vitro, researchers should implement a phosphatase assay that quantifies the conversion of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP). A methodological approach would include:

  • Preparation of purified recombinant uppP protein (using N-terminal 10xHis-tagged protein)

  • Isolation or synthesis of the UPP substrate

  • Establishment of an assay buffer system that mimics physiological conditions

  • Quantification of released inorganic phosphate using colorimetric methods

Reaction conditions should include appropriate divalent cations (likely Mg²⁺) and optimal pH conditions (generally around pH 7.5-8.0 for phosphatases). Activity can be measured by monitoring the release of inorganic phosphate using malachite green or similar colorimetric assays.

For kinetic analysis, researchers should:

  • Determine Km and Vmax values by varying UPP concentrations

  • Assess the effects of potential inhibitors on enzyme activity

  • Examine the impact of pH and temperature on catalytic efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.