Recombinant Nocardia farcinica UPF0060 membrane protein NFA_36830 (NFA_36830)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
NFA_36830; UPF0060 membrane protein NFA_36830
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Nocardia farcinica (strain IFM 10152)
Target Names
NFA_36830
Target Protein Sequence
MTVLRSLVLFGLAALAEIGGAWLVWQGWREHRGLWWIAAGVIALGAYGFVATFQPDPDFG RVLAAYGGVFVVGSLAWGVLVDRFRPDRWDLLGAGICLVGVAVIMYAPRGG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of NFA_36830?

NFA_36830 belongs to the UPF0060 family of membrane proteins found in Nocardia farcinica, a gram-positive, partially acid-fast bacterium known to cause nocardiosis in humans. As a transmembrane protein, its structure likely consists of multiple membrane-spanning domains similar to other characterized transmembrane proteins. While the exact structure of NFA_36830 is still being investigated, computational approaches for transmembrane protein design and analysis have advanced significantly in recent years.

Transmembrane proteins with multiple membrane-spanning regions present significant design challenges, but recent breakthroughs have enabled the successful design of monomers, homodimers, trimers, and tetramers with up to four membrane-spanning regions per subunit . These designed proteins demonstrate remarkable stability in membrane environments, as evidenced by magnetic tweezer unfolding experiments. The methodological approaches used in these studies can be applied to predict the structural characteristics of NFA_36830.

For experimental characterization, researchers typically employ a combination of crystallography, cryo-electron microscopy, and NMR spectroscopy to resolve protein structures. These methods can elucidate the precise arrangement of transmembrane domains and any extracellular or cytoplasmic regions that may participate in host-pathogen interactions.

How is recombinant NFA_36830 typically expressed and purified?

The expression and purification of recombinant transmembrane proteins present several challenges that must be addressed through methodological optimization. For NFA_36830, researchers should consider the following protocol based on established approaches for membrane proteins:

  • Vector selection: Choose expression vectors with fusion tags (His-tag, GST, MBP) at both N and C termini to facilitate detection of full-length protein and distinguish it from truncated products.

  • Expression system optimization: Evaluate multiple expression systems including E. coli, yeast (P. pastoris), insect cells, and mammalian cells to determine optimal expression conditions for functional protein.

  • Membrane extraction: Utilize gentle detergents (DDM, LMNG, or digitonin) for membrane solubilization while preserving the native protein conformation.

  • Purification strategy: Implement multi-step purification combining affinity chromatography, size exclusion chromatography, and ion exchange chromatography to achieve high purity.

Expression of transmembrane proteins often encounters challenges related to protein hydrophobicity, codon usage, and potential toxicity to host cells . For NFA_36830, researchers might need to analyze the protein sequence for rare codons and optimize the coding sequence accordingly. Additionally, maintaining the correct folding and stability of the protein during purification is critical for downstream functional studies.

What are the known functions of UPF0060 family proteins in bacterial pathogenesis?

The UPF0060 family includes uncharacterized proteins with conserved domains across various bacterial species. While the specific function of NFA_36830 requires further investigation, insights can be drawn from other Nocardia farcinica membrane proteins such as Nfa34810.

Nfa34810 has been identified as an immunodominant protein located in the cell wall of Nocardia farcinica that plays a significant role in bacterial pathogenesis . Research demonstrates that this protein facilitates bacterial invasion of host cells and interacts with the host immune system. Specifically, Nfa34810 enables the uptake and internalization of coated particles into HeLa cells, and deletion of the nfa34810 gene significantly attenuates bacterial infection capabilities in both HeLa and A549 cell lines .

From an immunological perspective, membrane proteins like Nfa34810 trigger macrophages to produce inflammatory cytokines, particularly tumor necrosis factor alpha (TNF-α). This process involves activation of mitogen-activated protein kinase (MAPK) and nuclear factor κB (NF-κB) signaling pathways through phosphorylation of ERK1/2, p38, JNK, p65, and AKT in macrophages . The mechanism appears to be TLR4-dependent, as neutralizing antibodies against Toll-like receptor 4 significantly inhibit TNF-α secretion.

How does NFA_36830 interact with host cell membranes and cellular components?

Understanding the interaction between NFA_36830 and host cell components requires sophisticated experimental approaches. Based on studies of related proteins, researchers should consider the following methodological approach:

  • Binding studies using recombinant protein: Utilize surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or microscale thermophoresis (MST) to quantify binding affinities between purified NFA_36830 and potential host cell receptors.

  • Cellular localization assays: Implement confocal microscopy with fluorescently labeled NFA_36830 to track protein localization within infected cells and co-localization with host cell components.

  • Pull-down assays and mass spectrometry: Identify interaction partners by performing immunoprecipitation of NFA_36830 from infected cells followed by proteomic analysis.

  • Functional domain mapping: Generate truncated versions or point mutations of NFA_36830 to identify specific domains responsible for host cell interactions.

Studies of the Nfa34810 protein have demonstrated that Nocardia farcinica membrane proteins can directly facilitate bacterial invasion of mammalian cells through specific interactions with host cell components . This suggests that NFA_36830 might similarly participate in the infection process, potentially through recognition of specific host cell receptors or by modulating membrane properties to facilitate bacterial entry.

For researchers investigating potential TLR interactions, the experimental approach should include blocking studies with neutralizing antibodies against different TLRs, as has been demonstrated with Nfa34810 and TLR4 . Additionally, reporter cell lines expressing individual TLR family members can help identify specific receptor interactions.

What signaling pathways are activated by NFA_36830 in host immune cells?

Elucidating the signaling pathways activated by NFA_36830 requires comprehensive analysis of host cell responses. A methodical research approach should include:

  • Cytokine profiling: Measure production of inflammatory cytokines (TNF-α, IL-6, IL-1β, etc.) using ELISA or multiplex cytokine assays following exposure of immune cells to purified NFA_36830.

  • Phosphorylation analysis: Perform Western blot analysis to detect phosphorylation of key signaling molecules in the MAPK (ERK1/2, p38, JNK), NF-κB (p65), and PI3K/AKT pathways at different time points after NFA_36830 stimulation.

  • Pathway inhibition studies: Utilize specific inhibitors of key signaling molecules to determine their contribution to NFA_36830-induced cellular responses.

  • Transcriptome analysis: Conduct RNA-Seq to comprehensively identify genes and pathways regulated by NFA_36830 in different immune cell populations.

Based on studies of Nfa34810, we can anticipate that NFA_36830 might activate similar signaling cascades. Nfa34810 stimulation triggers macrophages to produce TNF-α through the activation of MAPK and NF-κB signaling pathways . This activation involves the phosphorylation of ERK1/2, p38, JNK, p65, and AKT in macrophages. Specific inhibitors of ERK1/2, JNK, and NF-κB significantly reduce Nfa34810-induced TNF-α expression, indicating that production of this inflammatory cytokine depends on these kinases .

The following table summarizes potential signaling pathways and their inhibitors for studying NFA_36830-induced immune responses:

Signaling PathwayKey ComponentsSpecific InhibitorsExpected Effect on Cytokine Production
MAPK/ERKERK1/2U0126, PD98059Decreased TNF-α, IL-6 production
MAPK/JNKJNKSP600125Decreased TNF-α production
MAPK/p38p38SB203580Altered inflammatory response
NF-κBp65, IκBBAY 11-7082Significantly reduced TNF-α expression
PI3K/AKTAKTLY294002, WortmanninAltered cell survival and cytokine production

How does genetic variation in NFA_36830 affect protein function and bacterial virulence?

Investigating the relationship between genetic variation, protein function, and bacterial virulence requires a multifaceted approach combining genomic analysis, protein biochemistry, and infection models. Researchers should consider the following methodology:

  • Comparative genomic analysis: Sequence NFA_36830 from multiple Nocardia farcinica clinical isolates to identify naturally occurring variants and polymorphisms.

  • Structure-function analysis: Generate site-directed mutants targeting conserved residues or domains identified through computational analysis and assess their impact on protein folding, stability, and function.

  • Gene knockout and complementation: Create NFA_36830 deletion mutants (ΔNFA_36830) and complement with wild-type or variant genes to assess the contribution of specific genetic variations to bacterial phenotypes.

  • Infection models: Compare the virulence of wild-type, mutant, and complemented strains in cellular and animal infection models, measuring bacterial invasion, persistence, and host immune responses.

Studies with Nfa34810 have demonstrated that gene deletion significantly attenuates the ability of Nocardia farcinica to infect both HeLa and A549 cells . Similar approaches can be applied to NFA_36830 to determine its contribution to bacterial virulence. Researchers should also consider whether genetic variants of NFA_36830 correlate with clinical outcomes in patients with nocardiosis, which might indicate functional differences in protein activity.

What are the optimal conditions for expressing soluble and functional recombinant NFA_36830?

The expression of functional transmembrane proteins presents significant challenges that require systematic optimization. For NFA_36830, researchers should consider the following methodological approach:

  • Construct design options:

    • Full-length protein with N- and C-terminal tags

    • Truncated constructs excluding potentially problematic hydrophobic regions

    • Fusion with solubility-enhancing partners (MBP, SUMO, Trx)

  • Expression system selection:

    • Bacterial systems: E. coli BL21(DE3), C41(DE3), C43(DE3) (specialized for membrane proteins)

    • Eukaryotic systems: P. pastoris, insect cells (Sf9, Hi5), mammalian cells (HEK293, CHO)

  • Expression condition optimization:

    • Temperature: Test reduced temperatures (16-20°C) to minimize inclusion body formation

    • Induction: Compare IPTG concentrations or auto-induction media

    • Media supplements: Evaluate glycerol, sorbitol, or specific detergents to enhance proper folding

  • Solubilization and purification strategy:

    • Test multiple detergents (DDM, LMNG, CHAPS, digitonin) at different concentrations

    • Implement step-wise purification combining affinity, ion exchange, and size exclusion chromatography

    • Consider nanodiscs or amphipols for stabilizing the purified protein

Common challenges in full-length protein expression include truncated products due to proteolysis or improper translation initiation . To address these issues, researchers can use expression vectors with fusion tags on both ends to distinguish full-length proteins from truncated versions and increase imidazole concentration during elution to ensure purification of the complete protein.

How can researchers effectively study NFA_36830 interactions with host immune receptors?

Investigating protein-receptor interactions requires specialized techniques that preserve both protein conformation and receptor functionality. Researchers studying NFA_36830 should consider these methodological approaches:

  • In vitro binding assays:

    • Surface Plasmon Resonance (SPR): Immobilize purified NFA_36830 or potential receptors on sensor chips to measure real-time binding kinetics

    • Bio-Layer Interferometry (BLI): Determine association and dissociation rates between NFA_36830 and immune receptors

    • ELISA-based binding assays: Develop plate-based assays to screen multiple potential receptors

  • Cellular binding studies:

    • Flow cytometry with fluorescently labeled NFA_36830 to quantify binding to different immune cell populations

    • Confocal microscopy to visualize binding and potential co-localization with specific receptors

    • Competition assays with known ligands or blocking antibodies to identify specific binding sites

  • Receptor identification strategies:

    • Crosslinking coupled with mass spectrometry to identify direct binding partners

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to NFA_36830 in cellular environments

    • Yeast two-hybrid or mammalian two-hybrid screening to identify potential interacting proteins

Based on studies of Nfa34810, researchers should particularly focus on potential interactions with Toll-like receptors, especially TLR4 . Experimental approaches for investigating TLR interactions should include neutralizing antibody blocking experiments, reporter cell assays, and direct binding studies with recombinant TLR ectodomains.

What advanced imaging techniques are most appropriate for visualizing NFA_36830 localization in bacterial and host cells?

Visualizing transmembrane proteins requires specialized imaging techniques that provide high resolution and specificity. For NFA_36830 localization studies, researchers should consider the following methodological approach:

  • Sample preparation options:

    • Immunofluorescence using antibodies against NFA_36830 or epitope tags

    • Fusion with fluorescent proteins (GFP, mCherry) for live-cell imaging

    • Click chemistry labeling with small bioorthogonal tags for minimal interference with protein function

  • Imaging techniques by resolution requirement:

    • Confocal microscopy for conventional diffraction-limited imaging (resolution ~200 nm)

    • Super-resolution techniques for nanoscale visualization:

      • Structured Illumination Microscopy (SIM): 100-130 nm resolution

      • Stimulated Emission Depletion (STED): 30-80 nm resolution

      • Photoactivated Localization Microscopy (PALM)/Stochastic Optical Reconstruction Microscopy (STORM): 10-30 nm resolution

  • Dynamic analysis approaches:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

    • Förster Resonance Energy Transfer (FRET) to detect protein-protein interactions

    • Single-particle tracking to follow individual proteins over time

  • Correlative microscopy:

    • Correlative Light and Electron Microscopy (CLEM) to combine fluorescence localization with ultrastructural context

    • Cryo-electron tomography for visualizing proteins in their native cellular environment

For bacterial localization studies, immunogold labeling coupled with electron microscopy can provide high-resolution information about NFA_36830 distribution in the Nocardia farcinica cell wall, similar to localization studies performed with Nfa34810 . For host-pathogen interaction studies, live-cell imaging with spinning disk confocal microscopy can capture the dynamic process of bacterial invasion and protein translocation.

How should researchers interpret conflicting results between in vitro and in vivo studies of NFA_36830 function?

Discrepancies between in vitro and in vivo findings are common in protein function studies and require careful analysis to resolve. When faced with conflicting results regarding NFA_36830, researchers should consider the following methodological approach:

  • Systematic analysis of experimental conditions:

    • Compare protein preparation methods to ensure proper folding and activity

    • Evaluate differences in concentration ranges between in vitro and in vivo conditions

    • Assess the impact of the experimental microenvironment (pH, ionic strength, temperature)

  • Biological context considerations:

    • In vitro systems lack the complexity of cellular environments, including potential cofactors or binding partners

    • Protein modifications (glycosylation, phosphorylation) may differ between systems

    • Cellular compartmentalization may regulate protein activity in vivo

  • Validation strategies:

    • Implement complementary techniques to verify findings across multiple experimental platforms

    • Design intermediate complexity models (ex vivo systems, organoids) to bridge the gap between in vitro and in vivo studies

    • Develop computational models to account for differences in experimental conditions

  • Reconciliation approaches:

    • Consider that both results may be correct within their specific contexts

    • Propose a unified model that explains the seemingly contradictory findings

    • Design critical experiments to directly test the source of discrepancies

What statistical approaches are recommended for analyzing NFA_36830 structure-function relationship data?

Analyzing structure-function relationships for transmembrane proteins requires robust statistical methods that account for multiple variables and potential confounding factors. For NFA_36830 studies, researchers should consider the following statistical approaches:

  • Correlation analysis methods:

    • Pearson or Spearman correlation to quantify relationships between structural features and functional outcomes

    • Multiple regression analysis to identify structural determinants of specific functions

    • Principal Component Analysis (PCA) to reduce dimensionality and identify key structural variables

  • Comparative analysis approaches:

    • ANOVA with post-hoc tests for comparing multiple structural variants

    • Mixed-effects models for analyzing data with both fixed and random effects

    • Hierarchical clustering to identify patterns in structure-function relationships

  • Predictive modeling techniques:

    • Machine learning approaches (Random Forest, Support Vector Machines) to predict functional outcomes from structural features

    • Molecular dynamics simulation analysis to correlate structural dynamics with function

    • Bayesian statistical frameworks for integrating prior knowledge with experimental data

  • Validation and reproducibility considerations:

    • Cross-validation techniques to assess model robustness

    • Power analysis to ensure adequate sample size for detecting meaningful differences

    • Bootstrapping or permutation tests for non-parametric data

For researchers studying transmembrane proteins like NFA_36830, statistical analysis should account for the particular challenges of membrane protein structural studies, including limited resolution of hydrophobic domains and potential artifacts introduced during protein extraction and purification. Integration of computational prediction with experimental validation can strengthen the statistical significance of structure-function findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.