Recombinant Nocardia farcinica UPF0353 protein NFA_34780 (NFA_34780)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NFA_34780; UPF0353 protein NFA_34780
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Nocardia farcinica (strain IFM 10152)
Target Names
NFA_34780
Target Protein Sequence
MSISHFTALIWLGFLAVVALIALGYVLVQRSRHRQMLRFSNMEVLEKVAPSRPSPLRHAP IALMLVGLVFLTIAAAGPTSVQKVPRNRATVVLVMDVSLSMEATDVPPSRLEVAQQAGKE FVDGLTQGINLGFVTFAGTASVMQSPTTNREAVKAAIDNIKLAERTATGEGILTALQSIE TLATVLGGAETPPPARIVLMSDGKQTVPDDKDVDNPRHAFTAARLAKSKGIPVSTISFGT EWGSVEIPDQDGQGGSQRVKVPVDNESLREIAKLSGGEFYTASSLEELTAVYDTLEEQIG YETTRGDASRPWLLLGMLVVAAGIVTGLLYRQRLP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0353 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Nocardia farcinica UPF0353 protein NFA_34780?

NFA_34780 is a protein of unknown function (UPF0353) from the bacterial species Nocardia farcinica. It is a full-length protein consisting of 335 amino acids (residues 1-335) that can be produced as a recombinant protein with a histidine tag. The protein belongs to the UPF0353 protein family, which contains members whose biological functions have not yet been fully characterized in scientific literature . Nocardia farcinica is an aerobic actinomycete bacterium that shares taxonomic order (Actinomycetales) with other clinically significant bacteria such as Mycobacterium species.

What is currently known about the structural characteristics of NFA_34780?

The NFA_34780 protein has been successfully expressed as a recombinant protein in E. coli expression systems with a histidine tag, indicating that it can be produced in a soluble and purifiable form . The full-length protein contains 335 amino acids, though detailed three-dimensional structural information is not widely available in the current literature. Like other bacterial proteins in the UPF0353 family, it likely contains conserved domains that may provide clues to its function. Researchers interested in structural analysis would typically employ techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to determine its tertiary structure.

What expression systems have been validated for recombinant NFA_34780 production?

E. coli has been documented as a successful expression system for producing recombinant NFA_34780 with a histidine tag . This bacterial expression system likely employs standard vectors optimized for high-yield protein production. While specific optimization parameters are not detailed in the available literature, researchers typically consider factors such as temperature, induction conditions, and growth media composition when establishing expression protocols. Alternative expression systems such as yeast or mammalian cells might be considered for specialized applications requiring specific post-translational modifications, though such approaches would need validation.

What purification strategies are recommended for His-tagged NFA_34780?

For His-tagged NFA_34780 purification, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins represents the primary isolation method. A typical purification workflow would involve:

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • Binding to Ni-NTA resin in the presence of low imidazole concentrations (10-20 mM)

  • Sequential washing steps to remove non-specifically bound proteins

  • Elution using an imidazole gradient or step elution (typically 250-500 mM imidazole)

  • Buffer exchange to remove imidazole for downstream applications

Further purification may incorporate size exclusion chromatography or ion exchange chromatography to achieve higher purity if required for structural or functional studies.

How should researchers verify protein identity and integrity after purification?

Verification of recombinant NFA_34780 should employ multiple complementary approaches:

Verification MethodKey ParametersExpected Outcome
SDS-PAGEDenaturing conditionsSingle band at ~37-40 kDa (depending on tag size)
Western BlotAnti-His antibody or protein-specific antibodySpecific binding at expected molecular weight
Mass SpectrometryPeptide mass fingerprintingMatch to theoretical peptide fragments
N-terminal SequencingEdman degradationConfirmation of expected N-terminal sequence
Circular DichroismFar-UV spectrumSecondary structure profile

These methods collectively confirm the protein's identity, purity, and structural integrity before proceeding to functional assays .

What buffer conditions are typically optimal for maintaining NFA_34780 stability?

While specific buffer optimization data for NFA_34780 is not detailed in the available literature, researchers should consider testing several buffer compositions based on general principles for bacterial proteins:

Buffer ComponentTypical RangeRationale
pH7.0-8.0Match physiological conditions of Nocardia
Salt (NaCl)100-300 mMProvide ionic strength for stability
Reducing Agent1-5 mM DTT or BMEPrevent oxidation of cysteine residues
Glycerol5-10%Enhance protein stability during storage
Protease InhibitorsAs recommendedPrevent degradation during handling

Thermal shift assays (Differential Scanning Fluorimetry) can be employed to systematically optimize buffer conditions by measuring protein unfolding temperatures across different formulations .

What approaches can researchers use to investigate the function of NFA_34780?

Given that NFA_34780 belongs to the UPF0353 family of uncharacterized proteins, multiple complementary approaches should be employed to elucidate its function:

  • Bioinformatic analysis: Sequence alignment with known proteins, domain prediction, and phylogenetic analysis

  • Structural studies: X-ray crystallography or cryo-EM to identify structural similarities to proteins of known function

  • Protein-protein interaction studies: Pull-down assays, yeast two-hybrid screens, or proximity labeling to identify binding partners

  • Gene deletion/complementation studies: Creating knockout strains and assessing phenotypic changes

  • Transcriptomic analysis: Identifying co-expressed genes that may suggest functional relationships

  • Biochemical assays: Screening for enzymatic activities based on structural predictions

This multi-faceted approach increases the likelihood of functional characterization in the absence of prior knowledge .

How might NFA_34780 function in bacterial electron transport or metabolism?

Based on studies of related bacteria in the Actinomycetales order, proteins like NFA_34780 might participate in specialized metabolic pathways or respiratory processes. In Mycobacteria, which are taxonomically related to Nocardia, electron transport chains are branched, inducible, and modular, allowing adaptation to varying environmental conditions . These systems employ various electron donors (NADH, succinate) and acceptors to maintain energy production under different conditions.

A functional hypothesis for NFA_34780 might include roles in:

  • Electron transport under oxygen-restricted conditions

  • Alternative respiratory pathways during environmental stress

  • Metabolic adaptation during host infection

  • Redox homeostasis in changing environments

Researchers could investigate these possibilities using oxygen consumption assays, membrane potential measurements, or metabolic flux analysis in wild-type versus NFA_34780 knockout strains .

What is known about protein-protein interactions involving NFA_34780?

Current literature does not specify direct interaction partners for NFA_34780 . Researchers interested in mapping the protein's interaction network could employ:

  • Co-immunoprecipitation with anti-His antibodies followed by mass spectrometry

  • Bacterial two-hybrid screening against a Nocardia farcinica genomic library

  • Crosslinking mass spectrometry to identify proximity-based interactions

  • Surface plasmon resonance with candidate interacting proteins

  • Computational prediction of protein-protein interactions based on structural models

These approaches would help position NFA_34780 within the broader cellular network and provide insights into its functional roles within Nocardia farcinica.

How might researchers investigate the role of NFA_34780 in bacterial adaptation to environmental stresses?

Investigating the role of NFA_34780 in stress adaptation would benefit from examining its expression and function under relevant stress conditions. Experimental approaches could include:

  • Quantitative RT-PCR to measure NFA_34780 expression under various stresses (oxidative stress, nutrient limitation, anoxia, nitrosative stress)

  • Creation of reporter strains with promoter fusions to monitor expression in real-time

  • Phenotypic analysis of wild-type versus knockout strains under stress conditions

  • Complementation studies to confirm phenotype restoration

  • Transcriptomic and proteomic profiling to identify co-regulated genes during stress response

Studies on related organisms have shown that bacterial adaptation to anoxia and nitric oxide involves significant transcriptional reprogramming and metabolic adjustments . Similar approaches could be applied to understand NFA_34780's role in Nocardia farcinica.

What techniques can be used to study post-translational modifications of NFA_34780?

Post-translational modifications (PTMs) can significantly impact protein function. For NFA_34780, researchers should consider:

PTM TypeDetection MethodBiological Significance
PhosphorylationLC-MS/MS with phospho-enrichmentSignal transduction, activity regulation
AcetylationWestern blot with anti-acetyl lysine antibodiesMetabolic regulation, protein stability
MethylationMass spectrometry with neutral loss scanningProtein-protein interactions, localization
Redox ModificationsDifferential alkylation followed by MSResponse to oxidative stress
Proteolytic ProcessingN-terminal sequencing of mature proteinActivation, localization changes

Understanding these modifications would provide insights into how NFA_34780 activity might be regulated in response to changing environmental conditions .

How can researchers effectively model the structure-function relationship of NFA_34780?

In the absence of experimental structural data, computational approaches offer valuable insights:

  • Homology modeling based on structurally characterized proteins in the same family

  • Molecular dynamics simulations to predict conformational flexibility

  • Docking studies with potential substrates or interaction partners

  • Virtual screening to identify potential small molecule modulators

  • Site-directed mutagenesis of predicted functional residues followed by activity assays

These computational predictions should guide experimental design, with particular attention to conserved residues that might participate in catalysis or protein-protein interactions.

What are common challenges in obtaining functional recombinant NFA_34780 and how can they be addressed?

Researchers often encounter several challenges when working with recombinant bacterial proteins:

ChallengePotential SolutionRationale
Poor expressionOptimize codon usage for E. coliImproves translation efficiency
InsolubilityExpress at lower temperatures (16-20°C)Slows folding, reduces aggregation
Improper foldingCo-express with chaperones (GroEL/ES)Assists proper protein folding
Protein instabilityIdentify optimal buffer conditions via thermal shift assaysEnhances storage stability
Loss of functionTest multiple expression constructs with different tag positionsMinimizes tag interference with function
DegradationInclude protease inhibitors, express in protease-deficient strainsPrevents proteolytic breakdown

Systematic optimization of these parameters increases the likelihood of obtaining functionally active protein for downstream analyses .

How can contradictory experimental results with NFA_34780 be reconciled?

When facing contradictory results, researchers should systematically evaluate:

  • Protein quality: Verify that different batches maintain consistent purity, integrity, and folding

  • Experimental conditions: Standardize buffer components, temperature, pH, and ionic strength

  • Laboratory techniques: Establish standard operating procedures for key assays

  • Biological context: Consider differences between in vitro systems and the native environment

  • Strain variations: Account for potential differences in Nocardia farcinica strains used across studies

Documentation of detailed methods, reagents, and controls is essential for troubleshooting discrepancies and establishing reproducible protocols .

What are promising avenues for future research on NFA_34780?

Based on current understanding of bacterial metabolism and adaptation, several promising research directions emerge:

  • Structural characterization through X-ray crystallography or cryo-EM to inform function

  • Investigation of expression patterns during infection or environmental stress

  • Identification of small molecule modulators of NFA_34780 activity

  • Exploration of potential roles in virulence or antibiotic resistance

  • Comparative analysis across related Actinomycetales species to identify conserved functions

  • Integration of NFA_34780 into metabolic models of Nocardia farcinica

These approaches, particularly when combined in multidisciplinary studies, would significantly advance understanding of this uncharacterized protein and potentially reveal new aspects of Nocardia biology .

How can researchers effectively share NFA_34780 data and resources with the scientific community?

To facilitate collaborative research on NFA_34780 and related proteins, researchers should:

  • Deposit structural data in the Protein Data Bank

  • Share expression constructs through repositories like Addgene

  • Publish detailed protocols on platforms like protocols.io

  • Establish consistent nomenclature and annotation in protein databases

  • Develop standardized assays for functional characterization

  • Create and distribute knockout or modified strains through bacterial stock centers

These practices promote reproducibility and accelerate scientific progress through community-based research efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.