Recombinant Nocardioides sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpF; Noca_1759; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Nocardioides sp. (strain ATCC BAA-499 / JS614)
Target Names
atpF
Target Protein Sequence
MQALLAAPLAKAEELNPLLPHAIEIVLSLVVFGLLLFAVWKFVTPRFEQIYTERTQAIEG GLAAAETKQAEADAKLADLEQQLSEARHEAARIREEAREQGAQIIAEMREQAQADAARIV EHGKTQIEAERQQAVTSLRAEVGTLATSLAGRIVGESLEDDDRSARVVERFLADLETIEA SQAAGGGES
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F1 domain and the membrane-embedded proton channel F0 domain, linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the ATP synthase subunit b (atpF) in Nocardioides species?

ATP synthase subunit b (atpF) in Nocardioides species is a critical component of the F₀ portion of F₀F₁-ATP synthase, a membrane-bound enzyme complex responsible for ATP synthesis. This subunit forms part of the peripheral stalk that connects the F₁ catalytic domain to the membrane-embedded F₀ domain, providing structural stability to the complex during rotational catalysis. In Nocardioides species, which are known for their remarkable ability to survive in extreme environments and degrade challenging pollutants, ATP synthase plays a vital role in energy metabolism . The atpF gene encodes this protein, which contributes to the organism's ability to maintain energy homeostasis under various environmental stresses, including oxidative stress conditions that these bacteria frequently encounter.

How does the genomic context of atpF differ among Nocardioides species?

The genomic context of atpF varies among different Nocardioides species, reflecting their evolutionary adaptations to diverse environments. Most Nocardioides species have high G+C content genomes (ranging from 66.5 to 78.7 mol%), with Nocardioides arcticus having a G+C content of 73.61 mol% . The atpF gene typically exists within an ATP synthase operon, which includes other subunits of the F₀F₁-ATP synthase complex.

Genomic analysis of different Nocardioides strains reveals the following patterns:

Nocardioides SpeciesGenome Size (bp)G+C Content (mol%)atpF LocationNotable Genomic Features
N. arcticus Arc9.1364,414,28773.61Within ATP synthase operonCircular chromosome, 4239 coding genes
N. sp. WV_118_65,555,80472.74Within energy metabolism clusterSingle circular contig
N. sp. strain PD653Not specifiedNot specifiedNot specifically identifiedContains hcb gene operon for pollutant degradation

What expression systems are most effective for producing recombinant Nocardioides atpF protein?

For successful recombinant expression of Nocardioides atpF, Escherichia coli expression systems have proven effective when optimized properly. The high G+C content of Nocardioides genomes (typically 66.5-78.7 mol%) requires codon optimization strategies when expressing in E. coli hosts . Research indicates that BL21(DE3) E. coli strains coupled with vectors containing T7 promoters work effectively for expression of Nocardioides proteins.

Methodology for optimal expression includes:

  • Gene synthesis with codon optimization for E. coli

  • Cloning into expression vectors with strong inducible promoters (pET series vectors are commonly used)

  • Expression at lower temperatures (16-20°C) to improve protein folding

  • Addition of a histidine tag for purification via nickel affinity chromatography

  • Use of specialized E. coli strains designed for expression of proteins from high G+C content organisms

These approaches help overcome expression challenges associated with the significant difference in G+C content between Nocardioides species and common laboratory expression hosts.

How does the structure of Nocardioides sp. ATP synthase subunit b compare to that of other bacterial species?

The ATP synthase subunit b from Nocardioides species shares the fundamental structural elements found in other bacterial homologs while exhibiting species-specific adaptations. Like other bacterial atpF proteins, the Nocardioides version features an N-terminal membrane-anchoring domain and a predominantly α-helical C-terminal domain that forms a right-handed coiled coil in the native complex.

Comparative structural analysis suggests that the Nocardioides atpF protein contains adaptations that may contribute to functional stability under oxidative stress conditions. These adaptations potentially relate to the organism's remarkable ability to survive in harsh environments, including those with extreme oxidative stress. Sequence analysis shows conserved regions for interaction with the δ and α subunits of the F₁ complex, which are essential for proper assembly and function of the ATP synthase complex .

The protein's structure likely contributes to Nocardioides species' ability to maintain energy homeostasis under various stress conditions, including those that trigger oxidative stress responses as documented in Nocardioides arcticus .

What role does ATP synthase subunit b play in Nocardioides species' oxidative stress response?

ATP synthase subunit b plays a crucial role in maintaining cellular energy homeostasis during oxidative stress in Nocardioides species. Transcriptomic analyses of Nocardioides arcticus under H₂O₂-induced oxidative stress revealed significant changes in energy metabolism pathways, including modulation of ATP synthase complex components .

When exposed to oxidative stress conditions (such as 1 mM H₂O₂), Nocardioides species implement several adaptive strategies:

  • Enhanced carbohydrate transport and metabolism to efficiently utilize various carbon sources, producing ATP for DNA/protein repair and metal ion transport

  • Altered inorganic ion transport to maintain iron homeostasis and prevent Fenton reactions

  • Increased DNA repair and defense mechanisms

  • Changes in cell membrane lipid composition

How does the atpF gene integrate with other energy metabolism pathways in Nocardioides species?

The atpF gene in Nocardioides species functions as part of an integrated energy metabolism network, coordinating with other pathways to maintain cellular energy balance. This integration is particularly important for these bacteria, which have adapted to survive in nutrient-limited environments and degrade recalcitrant compounds .

Analysis of genomic data from various Nocardioides strains reveals that the ATP synthase operon, including atpF, is coordinated with electron transport chain components and carbohydrate metabolism pathways. In Nocardioides arcticus, oxidative stress induces upregulation of carbohydrate transport and metabolism genes alongside changes in ATP synthesis machinery, suggesting a coordinated response to maintain energy production .

The integration includes:

  • Coordination with electron transport chain components to maintain proton motive force

  • Regulation in concert with carbon metabolism pathways, especially during stress responses

  • Interaction with ion transport systems, particularly for maintaining iron homeostasis

  • Metabolic shifts during exposure to environmental pollutants or stressors

This integrated regulation allows Nocardioides species to maintain energy homeostasis across diverse environmental conditions, contributing to their remarkable adaptability and biodegradation capabilities.

What are the optimal protocols for expressing and purifying recombinant Nocardioides atpF protein for structural studies?

For high-quality recombinant Nocardioides atpF protein suitable for structural studies, the following optimized protocol is recommended:

Expression System:

  • Host: E. coli BL21(DE3) strain

  • Vector: pET-28a(+) with N-terminal His₆-tag

  • Promoter: T7 promoter with lac operator

Codon Optimization:
Due to the high G+C content of Nocardioides genomes (66.5-78.7 mol%) , codon optimization for E. coli expression is essential.

Expression Protocol:

  • Transform expression plasmid into E. coli BL21(DE3)

  • Grow in Terrific Broth at 37°C until OD₆₀₀ reaches 0.6-0.8

  • Cool culture to 18°C and induce with 0.5 mM IPTG

  • Continue expression for 16-18 hours at 18°C

  • Harvest cells by centrifugation (4,000 × g, 20 min, 4°C)

Purification Strategy:

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 5% glycerol)

  • Lyse cells using sonication or high-pressure homogenization

  • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Perform immobilized metal affinity chromatography using Ni-NTA resin

  • Apply size exclusion chromatography for final polishing

  • Assess protein purity by SDS-PAGE (>95% purity required for structural studies)

Storage Conditions:
Store purified protein in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol at -80°C for long-term storage or at 4°C for immediate use.

This protocol addresses the specific challenges associated with Nocardioides proteins, including codon usage bias and potential stability issues.

How can researchers effectively design site-directed mutagenesis experiments to study functional residues in Nocardioides atpF?

When designing site-directed mutagenesis experiments for Nocardioides atpF, researchers should follow this methodological approach:

Step 1: Target Residue Identification

  • Perform sequence alignment of atpF from multiple Nocardioides species and other bacterial homologs

  • Identify conserved residues likely to be functionally important

  • Focus on residues in domains responsible for:

    • Membrane anchoring (N-terminal)

    • Stalk formation (mid-region)

    • Interaction with F₁ subunits (C-terminal)

Step 2: Mutation Strategy Design

  • For functional studies, consider:

    • Conservative substitutions to assess the importance of specific chemical properties

    • Charge reversals to disrupt salt bridges or electrostatic interactions

    • Alanine scanning to identify essential residues

  • For stability studies, target residues involved in:

    • The dimer interface

    • Regions exposed to oxidative damage

Step 3: Primer Design and Mutagenesis Protocol

  • Design primers with 15-20 nucleotides flanking each side of the mutation site

  • Ensure primers have adequate GC content and appropriate Tm values

  • Use QuikChange or Q5 site-directed mutagenesis kits for efficient mutation introduction

Step 4: Validation and Functional Assessment

  • Verify mutations by DNA sequencing

  • Express and purify mutant proteins following the protocol in section 3.1

  • Assess functional impacts through:

    • ATP synthase activity assays

    • Binding studies with partner subunits

    • Stability assessments under oxidative stress conditions

Key Regions to Target:
Based on functional importance, prioritize mutations in:

  • The N-terminal membrane anchor domain, which is crucial for integration into the membrane

  • The dimerization interface, essential for proper stalk formation

  • The C-terminal domain that interacts with the F₁ sector

  • Residues potentially involved in the response to oxidative stress

This systematic approach will help identify functionally critical residues and understand their roles in Nocardioides atpF function, particularly in relation to the organism's stress response mechanisms.

What techniques can be used to study the interaction between atpF and other ATP synthase subunits in Nocardioides species?

To comprehensively study interactions between atpF and other ATP synthase subunits in Nocardioides species, researchers can employ the following techniques:

In Vitro Interaction Analysis:

  • Pull-down Assays: Using His-tagged atpF as bait to capture interacting partners from Nocardioides cell lysates

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between purified atpF and other subunits

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of binding

  • Microscale Thermophoresis (MST): For analyzing interactions under near-native conditions

Structural Studies:

  • Cryo-Electron Microscopy: For visualizing the intact ATP synthase complex

  • X-ray Crystallography: Of reconstituted subcomplexes containing atpF

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map interaction interfaces

  • Cross-linking Mass Spectrometry (XL-MS): To identify proximity relationships between subunits

In Vivo Approaches:

  • Bacterial Two-Hybrid Assays: Adapted for high G+C content genes

  • FRET-based Assays: Using fluorescently tagged subunits

  • Co-immunoprecipitation: With antibodies against atpF or other subunits

  • In vivo Cross-linking: To capture transient interactions

Functional Validation:

  • Complementation Experiments: In ATP synthase-deficient strains

  • ATP Synthesis Assays: Using reconstituted proteoliposomes

  • Membrane Potential Measurements: To assess the impact of mutations on proton translocation

When applying these techniques to Nocardioides species, researchers should consider the organism's high G+C content and potential adaptation to environmental stresses. For instance, interaction studies should include conditions mimicking oxidative stress to understand how subunit interactions may be modulated during stress responses, as indicated by the adaptive mechanisms observed in Nocardioides arcticus .

How can structural insights from Nocardioides atpF be applied to understanding ATP synthase resistance to oxidative stress?

Structural insights from Nocardioides atpF can significantly advance our understanding of ATP synthase resistance to oxidative stress, particularly given the documented adaptations of Nocardioides species to high oxidative stress environments . Research approaches should focus on:

Structural Features Conferring Oxidative Resistance:
Nocardioides species demonstrate remarkable adaptation to oxidative stress conditions. Comparative structural analysis of atpF from Nocardioides with less stress-resistant organisms can reveal:

  • Modified amino acid composition to reduce susceptibility to oxidation (fewer oxidation-prone residues like methionine and cysteine in critical regions)

  • Structural elements that protect vulnerable sites from reactive oxygen species (ROS)

  • Unique folding patterns that maintain functional integrity under oxidative conditions

Experimental Approaches:

  • Solve high-resolution structures of Nocardioides atpF under normal and oxidative stress conditions

  • Perform site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy to monitor structural changes under oxidative stress

  • Use molecular dynamics simulations to identify regions with enhanced stability during oxidative challenge

Mechanistic Insights:
Research on Nocardioides arcticus has shown that under oxidative stress (1 mM H₂O₂), these bacteria implement several strategies including altered ion transport and metabolism, enhanced DNA repair, and changes in cell membrane composition . The ATP synthase complex, including subunit b, likely plays crucial roles in these adaptive responses by:

  • Maintaining energy production under stress conditions

  • Potentially adopting conformational changes that preserve function despite oxidative damage

  • Contributing to membrane stability through its transmembrane domain

Understanding these mechanisms could lead to engineering oxidative stress-resistant ATP synthases for biotechnological applications or provide insights into mitochondrial diseases associated with oxidative damage to ATP synthase.

What are the most effective approaches for analyzing the role of atpF in Nocardioides species' adaptation to extreme environments?

To comprehensively analyze the role of atpF in Nocardioides species' adaptation to extreme environments, researchers should implement multifaceted approaches that integrate genetic, biochemical, and physiological methods:

1. Comparative Genomics and Transcriptomics:

  • Compare atpF sequences and expression patterns across Nocardioides strains from different environments

  • Conduct RNA-seq analysis under simulated extreme conditions (temperature, pH, oxidative stress)

  • Identify regulatory elements controlling atpF expression under stress conditions

2. Genetic Manipulation Strategies:

  • Generate atpF knockout or knockdown mutants using CRISPR-Cas systems adapted for high G+C organisms

  • Create site-directed mutants targeting residues unique to extremophilic Nocardioides

  • Develop complementation systems with atpF variants from different species/environments

3. Biochemical and Biophysical Characterization:

  • Compare stability and activity of atpF and assembled ATP synthase complexes under extreme conditions

  • Measure thermal stability and pH resistance profiles of recombinant atpF proteins

  • Analyze structural changes using circular dichroism and fluorescence spectroscopy under varying conditions

4. Physiological Studies:

  • Monitor ATP production rates in wild-type vs. atpF-modified strains under stress conditions

  • Assess membrane potential maintenance during environmental challenges

  • Measure growth kinetics and survival rates under extreme conditions

Case Study: Oxidative Stress Adaptation
Nocardioides arcticus demonstrates specific adaptations to oxidative stress, including altered carbohydrate metabolism, ion transport, and membrane composition . To investigate atpF's contribution:

  • Compare gene expression and protein levels of atpF before and after H₂O₂ exposure

  • Analyze post-translational modifications of atpF under oxidative stress

  • Assess ATP synthase assembly and activity in membrane preparations from stressed cells

  • Identify potential interacting partners specific to stress conditions

These approaches can reveal how atpF contributes to the remarkable environmental adaptability of Nocardioides species, with implications for understanding fundamental principles of adaptation to extreme environments.

How do mutations in the atpF gene affect the bioenergetics of Nocardioides species during biodegradation of environmental pollutants?

The relationship between atpF mutations and bioenergetics during biodegradation processes is a complex area requiring sophisticated experimental approaches:

Methodological Framework:

1. Engineering Defined atpF Mutants:

  • Create a library of site-directed mutants targeting functional domains

  • Develop inducible expression systems to control mutant atpF levels

  • Generate chromosomal point mutations using precision genome editing techniques

2. Bioenergetic Analysis During Biodegradation:

  • Measure ATP/ADP ratios during degradation of specific pollutants

  • Monitor proton motive force using fluorescent probes

  • Quantify oxygen consumption rates and H+/ATP ratios

  • Assess maintenance energy requirements under different degradation conditions

3. Pollutant Degradation Efficiency Studies:

  • Compare degradation rates of model pollutants (e.g., hexachlorobenzene , 2,4-dinitroanisole , organofluorine compounds )

  • Determine Michaelis-Menten kinetics for degradation pathways

  • Measure growth yields on different pollutants for wild-type vs. atpF mutants

4. Integrative Systems Biology:

  • Perform metabolic flux analysis to track carbon and energy flow

  • Develop constraint-based models incorporating ATP synthase activity

  • Correlate transcriptomic and proteomic data with bioenergetic parameters

Research Findings Table: Predicted Effects of atpF Mutations on Biodegradation

Mutation TypeDomain AffectedPredicted Bioenergetic ImpactExpected Effect on Biodegradation
Conservative mutations in membrane domainMembrane anchoringMinimal impact on proton translocationSlight reduction in degradation efficiency
Mutations at dimerization interfaceStalk stabilityReduced ATP synthesis efficiencyModerate decrease in growth yield on pollutants
C-terminal mutationsF₁ interactionUncoupling of proton translocation from ATP synthesisSevere reduction in degradation capacity
Mutations in oxidative stress-responsive regionsStress adaptationDecreased ATP synthesis under stressImpaired degradation in oxidative environments

This integrated approach would provide valuable insights into how energy conservation through ATP synthase directly impacts the biodegradation capabilities of Nocardioides species, which are recognized as "specialists" for hard-to-degrade pollutants in the environment .

What are the potential applications of engineered Nocardioides atpF variants in bioremediation technologies?

Engineered Nocardioides atpF variants present promising opportunities for enhancing bioremediation technologies, particularly for challenging environmental contaminants. The strategic modification of this ATP synthase component could improve the bioenergetic efficiency and stress tolerance of Nocardioides strains used in bioremediation applications.

Potential Applications and Methodological Approaches:

1. Enhanced Oxidative Stress Resistance:

  • Engineer atpF variants with increased resistance to reactive oxygen species generated during pollutant degradation

  • Modify residues susceptible to oxidative damage based on comparative analysis with extremophiles

  • Validate enhanced performance in bench-scale bioremediation experiments with oxidative pollutants

2. Improved Energy Efficiency During Biodegradation:

  • Design atpF variants optimized for ATP production under the low-nutrient conditions typical of contaminated sites

  • Modify regulatory elements to maintain optimal ATP synthase expression during biodegradation

  • Field-test engineered strains at pilot sites contaminated with recalcitrant compounds

3. Cold-Adapted Variants for Low-Temperature Bioremediation:

  • Incorporate structural features from psychrophilic organisms into Nocardioides atpF

  • Select for variants with enhanced flexibility and catalytic efficiency at low temperatures

  • Validate performance in simulated cold-climate bioremediation scenarios

4. Co-Metabolic Degradation Enhancement:

  • Engineer atpF to optimize energy conservation during co-metabolic degradation processes

  • Develop variants that reduce the energetic burden of maintaining catabolic enzymes

  • Test engineered strains on mixed pollutant systems requiring co-metabolism

Nocardioides species have demonstrated remarkable capabilities for degrading challenging pollutants such as hexachlorobenzene , 2,4-dinitroanisole , and organofluorine compounds . Engineering the atpF component of their ATP synthase could further enhance these capabilities by improving energy conservation during degradation processes, potentially expanding the range of compounds amenable to bioremediation and increasing degradation rates under challenging environmental conditions.

How might comparative studies of atpF across Nocardioides species inform our understanding of bacterial adaptation to diverse ecological niches?

Comparative studies of atpF across Nocardioides species offer a valuable window into bacterial adaptation mechanisms to diverse ecological niches. These analyses can reveal evolutionary patterns that connect energy metabolism to environmental specialization.

Methodological Framework for Comparative Analysis:

1. Phylogenomic Approach:

  • Construct phylogenetic trees based on atpF sequences from Nocardioides species isolated from diverse environments

  • Correlate atpF sequence variations with specific ecological adaptations

  • Identify instances of convergent evolution in atpF across distantly related strains from similar environments

2. Structure-Function Correlation:

  • Map sequence variations to structural models of atpF

  • Identify ecological niche-specific structural adaptations

  • Compare adaptive features with those of distantly related bacteria from similar niches

3. Experimental Validation:

  • Perform reciprocal gene replacements between Nocardioides species from different niches

  • Assess fitness effects of atpF variants in non-native ecological contexts

  • Measure ATP synthesis efficiency under conditions mimicking different ecological niches

Ecological Adaptations Table:

Ecological NicheNocardioides SpeciesPredicted atpF AdaptationsFunctional Significance
Arctic marine sedimentsN. arcticusCold-stability features, oxidative stress resistanceMaintains ATP synthesis at low temperatures and under UV-induced stress
Pollutant-contaminated soilN. sp. strain PD653Resistance to chemical stressors, enhanced energetic efficiencySupports energetic demands of detoxification pathways
Wastewater systemsN. sp. str. WV_118_6Adaptation to fluctuating conditions, tolerance to chemical mixturesEnables persistence in complex waste streams
Low-nutrient environmentsVarious Nocardioides spp.Energy conservation features, high coupling efficiencyMaximizes ATP yield from limited energy sources

This comparative approach would provide insights into how fundamental cellular processes like ATP synthesis have been modified through evolution to support specialization to diverse ecological niches. The exceptional adaptability of Nocardioides species, as evidenced by their presence in environments ranging from Arctic sediments to pollutant-contaminated sites , makes them excellent models for studying the molecular basis of bacterial adaptation.

What novel experimental techniques could advance our understanding of the role of atpF in Nocardioides metabolism and stress response?

Several cutting-edge experimental techniques could significantly advance our understanding of atpF's role in Nocardioides metabolism and stress response. These methodologies transcend traditional approaches and offer unprecedented insights into protein function, regulation, and dynamics.

Innovative Methodological Approaches:

1. Advanced Imaging Techniques:

  • Cryo-Electron Tomography: Visualize native ATP synthase complexes in flash-frozen Nocardioides cells under various stress conditions

  • Single-Molecule FRET: Track conformational changes in atpF during the catalytic cycle in real-time

  • Super-Resolution Microscopy: Map the distribution and dynamics of ATP synthase complexes in living Nocardioides cells during stress responses

2. Cutting-Edge Genetic Approaches:

  • CRISPRi Systems Optimized for High G+C Genomes: Develop tunable repression systems for atpF to assess dosage effects on stress tolerance

  • Genome-Wide Interaction Screens: Identify genetic interactions with atpF using transposon sequencing or synthetic genetic arrays

  • In Vivo Mutation Scanning: Apply deep mutational scanning to atpF in Nocardioides under stress conditions

3. Systems Biology Integration:

  • Multi-Omics Time Course Analysis: Capture dynamic changes in transcript, protein, and metabolite levels during stress adaptation

  • Metabolic Flux Analysis with Stable Isotopes: Quantify energy flux distributions in wild-type versus atpF-modified strains

  • Network Analysis of ATP-Dependent Processes: Map the relationships between ATP production and consumption during stress responses

4. Advanced Biochemical Approaches:

  • Native Mass Spectrometry: Analyze intact ATP synthase complexes to understand subunit stoichiometry and stability

  • Time-Resolved X-ray Footprinting: Map dynamic changes in atpF structure during oxidative stress

  • Nanopore-Based Techniques: Study single ATP synthase complexes reconstituted into artificial membranes

Potential Research Outcomes Table:

Novel TechniqueApplication to Nocardioides atpFExpected New Insights
Cryo-electron tomographyVisualization of ATP synthase in native membrane environmentStructural adaptations under stress conditions
Real-time metabolic flux analysisMeasurement of ATP synthesis rates during pollutant degradationEnergetic bottlenecks in biodegradation pathways
In vivo mutation scanningComprehensive fitness mapping of atpF variantsCritical residues for stress adaptation
Single-molecule FRETConformational dynamics of atpF under oxidative stressMechanism of maintained function during stress

These innovative approaches would contribute significantly to our understanding of how Nocardioides species maintain bioenergetic homeostasis during environmental challenges, potentially informing biotechnological applications including enhanced bioremediation strategies and the development of stress-resistant biocatalysts.

What are the most promising future research directions for understanding the role of ATP synthase in Nocardioides species' remarkable environmental adaptability?

The investigation of ATP synthase, particularly the atpF subunit, in Nocardioides species represents a fertile area for future research with significant implications for understanding bacterial adaptation to challenging environments. Several promising research directions emerge:

1. Structural Biology and Protein Engineering:

  • Determine high-resolution structures of Nocardioides ATP synthase under various stress conditions

  • Engineer chimeric ATP synthase complexes combining features from different Nocardioides species to understand niche-specific adaptations

  • Develop atpF variants with enhanced stability and activity for biotechnological applications

2. Systems Biology of Energy Conservation:

  • Map the regulatory networks controlling ATP synthase expression during environmental stress

  • Develop predictive models of energy flux during biodegradation processes

  • Investigate the cross-talk between ATP synthase and stress response pathways

3. Evolutionary Biology and Adaptation:

  • Trace the evolutionary history of atpF across the Nocardioides genus and correlate sequence changes with ecological adaptation

  • Study horizontal gene transfer events involving ATP synthase genes

  • Investigate the co-evolution of atpF with other components of cellular energy systems

4. Applied Research:

  • Develop enhanced bioremediation strains with optimized ATP synthase components

  • Explore the potential of Nocardioides ATP synthase components as biotemplates for nanoscale energy conversion devices

  • Investigate pharmaceutical applications targeting unique features of Nocardioides ATP synthase

These research directions build upon the current knowledge of Nocardioides species' remarkable adaptability to extreme environments and their capabilities in biodegrading recalcitrant pollutants . Understanding the bioenergetic foundations of these capabilities through the study of ATP synthase will not only advance fundamental science but also contribute to practical applications in environmental biotechnology.

How might insights from Nocardioides atpF research contribute to broader understanding of bacterial bioenergetics and adaptation?

Research on Nocardioides atpF has the potential to significantly broaden our understanding of bacterial bioenergetics and adaptation mechanisms, with implications extending far beyond this specific genus:

Contributions to Fundamental Knowledge:

1. Adaptations to Extreme Environments:

  • Nocardioides species, particularly those like N. arcticus from the Arctic marine environment , provide models for understanding how energy conservation mechanisms adapt to extreme conditions

  • The study of atpF adaptations can reveal general principles of protein evolution in response to environmental stress

2. Bioenergetic Efficiency in Resource-Limited Conditions:

  • Many Nocardioides species thrive in nutrient-poor environments, suggesting optimized energy conservation strategies

  • Insights into ATP synthase efficiency could inform our understanding of minimal energy requirements for bacterial survival

3. Evolution of Bacterial Energy Systems:

  • Comparative analysis of atpF across the Actinobacteria phylum could reveal how ATP synthase has evolved in high G+C content organisms

  • Identification of convergent adaptations in distantly related extremophiles would highlight universal solutions to bioenergetic challenges

Translational Implications:

1. Biotechnology Applications:

  • Design principles derived from Nocardioides atpF could inform the engineering of stress-resistant enzymes

  • Insights into energy efficiency might guide metabolic engineering of industrial production strains

2. Environmental Biotechnology:

  • Understanding the bioenergetics of pollutant degradation could lead to improved bioremediation strategies

  • Knowledge of energy conservation during stress could enhance the design of biocontainment systems

3. Synthetic Biology:

  • ATP synthase components adapted for extreme conditions could serve as parts for synthetic organisms designed to function in challenging environments

  • Modular design principles from ATP synthase could inform the development of artificial energy-harvesting systems

By elucidating the unique adaptations of ATP synthase in Nocardioides species, researchers can uncover broader principles of how central energy metabolism evolves in response to environmental challenges, contributing to our fundamental understanding of life's adaptability and resilience.

What are the key methodological challenges that must be overcome to advance research on recombinant Nocardioides ATP synthase subunit b?

Advancing research on recombinant Nocardioides ATP synthase subunit b faces several methodological challenges that require innovative solutions:

Technical Challenges and Proposed Solutions:

1. Expression and Purification Challenges:

  • Challenge: The high G+C content (66.5-78.7 mol%) of Nocardioides genomes creates codon usage incompatibilities in common expression hosts

  • Solution: Develop specialized expression systems with optimized codon usage, potentially including Nocardioides-derived expression hosts or synthetic biology approaches to adapt E. coli for high-G+C gene expression

2. Structural Analysis Limitations:

  • Challenge: The membrane-associated nature of atpF complicates structural studies

  • Solution: Implement hybrid approaches combining cryo-EM, X-ray crystallography, and computational modeling; develop improved membrane mimetics for structural studies of the hydrophobic domains

3. Functional Reconstitution Difficulties:

  • Challenge: Assembling functional ATP synthase complexes with recombinant components

  • Solution: Develop cell-free expression systems that allow co-translation of multiple subunits in the presence of appropriate lipids; optimize reconstitution protocols specifically for Nocardioides ATP synthase components

4. In Vivo Analysis Constraints:

  • Challenge: Limited genetic tools for Nocardioides species

  • Solution: Adapt CRISPR-Cas systems for high G+C organisms; develop shuttle vectors and inducible expression systems specifically for Nocardioides

5. Ecological Relevance of Laboratory Studies:

  • Challenge: Laboratory conditions may not accurately reflect the complex environments where Nocardioides species naturally function

  • Solution: Develop microfluidic systems that better mimic natural environments; implement in situ studies using reporter systems to monitor ATP synthase activity in environmental samples

Advanced Methodological Framework:

Challenge CategoryCurrent LimitationsInnovative ApproachesExpected Outcomes
Genetic manipulationFew tools for high G+C organismsCRISPR-based systems optimized for NocardioidesPrecise genetic manipulation capabilities
Protein expressionCodon bias issues in E. coliSynthetic hosts with optimized translation machineryHigher yields of properly folded protein
Structural analysisDifficulty with membrane domainsAdvanced lipid nanodiscs and native MS approachesComplete structural models including membrane domains
Functional studiesArtificial conditions in reconstituted systemsBiomimetic membranes with environmental stress integrationMore ecologically relevant functional insights

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.