Recombinant Nocardioides sp. Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

CobS (adenosylcobinamide-GDP ribazoletransferase) is a 229-amino acid protein (UniProt ID: A1SJN0) expressed in Escherichia coli with an N-terminal His-tag for purification . Key features include:

PropertyDetails
Molecular Weight55–56 kDa (predicted)
Protein LengthFull-length (1-229 residues)
Catalytic ActivityAttaches 5,6-dimethylbenzimidazole to adenosylcobinamide-GDP
Expression SystemE. coli (optimized for soluble production)
Purity>90% (SDS-PAGE)
Storage StabilityStable at -80°C in Tris/PBS buffer with 6% trehalose

CobS operates in the aerobic cobalamin biosynthesis pathway, converting adenosylcobinamide-GDP into adenosylcobalamin-5'-phosphate, a precursor of active vitamin B<sub>12</sub> .

Recombinant Production and Purification

The cobS gene from Nocardioides sp. (strain BAA-499/JS614) is cloned into E. coli vectors, yielding soluble protein through affinity chromatography . Critical steps include:

  • Codon Optimization: Enhanced expression in E. coli hosts .

  • Tagging: His-tag facilitates nickel-chelate affinity purification .

  • Buffer Compatibility: Stable in Tris/PBS at pH 8.0 with glycerol for long-term storage .

Biochemical and Kinetic Properties

  • Substrate Specificity: CobS requires adenosylcobinamide-GDP and 5,6-dimethylbenzimidazole (DMB) as substrates .

  • pH Optimum: Functions optimally at neutral to slightly alkaline pH (7.5–8.5) .

  • Cofactor Dependence: Cobalt insertion precedes CobS activity, as shown in related Salmonella and E. coli homologs .

Comparative Analysis with Homologs

CobS shares functional similarities with homologs from other bacteria but exhibits unique traits:

OrganismCobS FeatureReference
Nocardioides sp.Aerobic pathway; His-tagged recombinant form
Escherichia coliPart of cob operon; requires cobinamide
Methylibium petroleiphilumTandem cob gene clusters; cobalt-dependent

The Nocardioides CobS lacks anaerobic cbi gene clusters, aligning it with aerobic biosynthesis pathways .

Applications in Biotechnology

  • Vitamin B<sub>12</sub> Production: Recombinant CobS enables scalable synthesis of cobalamin for pharmaceuticals and supplements .

  • Environmental Remediation: Nocardioides species degrade pollutants (e.g., hydrocarbons, steroids), and CobS supports their metabolic versatility .

  • Enzyme Engineering: Structural studies of CobS could improve catalytic efficiency for industrial biocatalysis .

Research Gaps and Future Directions

  • Structural Data: No crystal structure of Nocardioides CobS is available, limiting mechanistic insights .

  • Substrate Engineering: Potential to modify CobS for non-natural cobalamin analogs .

  • Biodegradation Pathways: Role of CobS in Nocardioides pollutant degradation merits further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Noca_2511; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Nocardioides sp. (strain ATCC BAA-499 / JS614)
Target Names
cobS
Target Protein Sequence
MRDAWRFAVGTLTALPVRPPTRVDRDTARRAMLLAPLAALPLGLLVAAVLAAGRAVELPP LAVGLLAVGALAASSRALHWDGLSDTVDGLAASYDPARSLAVMRSGTSGPAGVLATVVVA GVQAAALATLLDQPLLAGALVCLSRCALWIVCCTRVPAARADGLGADVARTVPLPVAVLG GLLLSAVGGLVVLVLVRRTVRRFGGVTGDVMGAAVELALAATLLAWAAR
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) from *Nocardioides sp.* catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its role in cobalamin biosynthesis?

Cobalamin synthase (cobS) is a polytopic integral membrane protein that catalyzes the penultimate step in the coenzyme B12 (cobamide) biosynthesis pathway. Specifically, cobS (EC 2.7.8.26) functions as a cobamide 5'-P synthase that condenses adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-phosphate (α-RP) to yield adenosylcobalamin phosphate (AdoCbl-P) . This reaction is critical in the "late" steps of cobamide biosynthesis, which involves activation of the corrin ring, activation of the nucleobase, condensation of activated precursors, and phosphatase activity to yield the final product. The unique feature of cobS is its membrane association, which is conserved across all bacteria and archaea that synthesize cobamides de novo, suggesting that membrane localization is essential for its function .

Why is cobS preferentially studied as a recombinant protein?

Studying native cobS presents significant challenges due to its:

  • Low natural expression levels in most organisms

  • Complex membrane association making isolation difficult

  • Need for controlled experimental conditions to investigate functionality

Recombinant expression provides several advantages:

  • Ability to produce higher quantities for biochemical and structural studies

  • Introduction of affinity tags (such as His-tags) for simplified purification

  • Opportunity to study protein variants through site-directed mutagenesis

  • Controlled expression conditions to minimize toxic effects observed with overexpression

What cellular effects occur when cobS is overexpressed in bacterial systems?

Overexpression of cobS in bacterial systems, particularly E. coli, causes several detrimental physiological effects:

  • Proton Motive Force (PMF) Dissipation: Studies using ethidium bromide (EtBr) accumulation assays have demonstrated that elevated levels of cobS significantly increase the rate of EtBr accumulation, indicating PMF dissipation .

  • Membrane Permeability Alterations: CobS overexpression leads to increased membrane permeability, compromising cellular integrity .

  • Reduced Cell Viability: Elevated cobS levels cause a significant decrease in colony-forming units (CFU), with viability declining in direct proportion to the level of cobS expression .

  • Cell Division Defects: Microscopy analyses reveal that populations of cobS-overexpressing cells largely lack divisional septa and show numerous elongated cells, suggesting interference with cell division and possibly DNA replication processes .

These effects occur with both enzymatically active and inactive (D82A mutant) versions of cobS, indicating that the membrane association of the protein itself, rather than its catalytic activity, is primarily responsible for these cellular disruptions .

What strategies can mitigate the negative effects of cobS overexpression in experimental systems?

Two effective strategies have been identified to counteract the membrane stress caused by elevated cobS levels:

  • Coexpression with CobC: The AdoCbl-P phosphatase (CobC) that catalyzes the final step in the cobamide biosynthesis pathway significantly reduces the negative effects of cobS overexpression. Balanced coexpression of CobC with cobS ameliorates the detrimental effects on PMF and improves cell viability .

  • Coexpression with PspA: Phage shock protein A (PspA), which plays a role in PMF maintenance, counteracts the membrane stress caused by cobS overexpression. When expressed alongside cobS, PspA helps maintain membrane integrity and cell viability .

ConditionEffect on EtBr AccumulationEffect on Cell Viability
CobS alone (0.5-1.0 mM IPTG)Significant increaseSignificant decrease
CobS + CobCMinimal increaseMaintained viability
CobS + PspAMinimal increaseMaintained viability
Vector controlNo increaseNormal viability

These findings suggest that experimental designs involving cobS should consider coexpression strategies to maintain cellular health and maximize protein production .

How does the membrane localization of cobS influence its function in the cobamide biosynthesis pathway?

The membrane association of cobS appears critical for its biological function based on several lines of evidence:

  • Conservation across species: All bacteria and archaea that synthesize cobamides de novo possess membrane-associated cobS homologues, suggesting evolutionary importance of this localization .

  • Potential for multi-enzyme complex formation: Research suggests that cobS serves as an anchor for a multi-enzyme complex that catalyzes the late steps of CoB12 biosynthesis. This complex likely includes CobC, as evidenced by in vitro studies showing that CobC association with liposomes depends on the presence of cobS .

  • Spatial organization: Membrane localization may provide spatial organization that facilitates the sequential reactions of the pathway, potentially improving efficiency or protecting intermediates from competing reactions .

  • PMF utilization: The membrane association may allow cobS to utilize the proton motive force for its catalytic activity, though this requires further investigation .

This membrane localization represents an intriguing aspect of cobamide biosynthesis that warrants continued research to fully understand its functional significance.

What expression systems are optimal for producing functional recombinant Nocardioides sp. cobS?

Based on available research, the following expression system considerations are important:

  • Host organism: E. coli has been successfully used to express recombinant Nocardioides sp. cobS, though careful regulation of expression levels is crucial to avoid toxicity .

  • Expression vectors: Vectors with tunable promoters (such as T7 with IPTG induction) allow for controlled expression to balance protein yield with host viability .

  • Coexpression strategies: Using dual-expression vectors (like pRSFDUET-1) to coexpress cobS with CobC or PspA significantly improves host viability and potentially protein yield .

  • Tags and fusion partners: N-terminal His-tags have been successfully used for purification without compromising function, as demonstrated with Nocardioides sp. cobS (1-229aa) .

  • Induction conditions: Low inducer concentrations and reduced temperatures (16-25°C) during induction may help balance expression with reduced toxicity .

What purification and storage considerations are important for maintaining cobS activity?

For optimal handling of recombinant cobS:

Purification considerations:

  • Membrane protein extraction requires careful detergent selection to solubilize while maintaining structure and function

  • Affinity chromatography using His-tag is effective for initial purification

  • Buffer conditions should be optimized to stabilize the membrane protein structure

Storage recommendations:

  • Store reconstituted protein in Tris/PBS-based buffer, pH 8.0 with 6% trehalose

  • Add glycerol (30-50% final concentration) for long-term storage

  • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

What methods can be used to assess cobS activity and membrane effects?

Several complementary approaches can be employed to evaluate cobS functionality:

For enzyme activity:

  • Biochemical assays: Monitor the condensation of AdoCbi-GDP and α-RP to form AdoCbl-P using HPLC or spectroscopic methods

  • Liposome-based assays: Reconstitute cobS in liposomes to study its activity in a membrane environment

For membrane effects:

  • Ethidium bromide accumulation assay: Quantifies changes in membrane permeability and PMF dissipation

  • Membrane potential-sensitive dyes: Alternative approach to monitor PMF disruption

  • Viability assessment: CFU counting to determine the impact on cell survival

  • Microscopy: Fluorescence microscopy with membrane stains to visualize changes in cell morphology and divisional septa formation

How can cobS research contribute to understanding membrane protein biology?

CobS presents a unique model system for studying:

  • Membrane protein topology and folding: The polytopic nature of cobS makes it valuable for investigating membrane protein biogenesis and folding mechanisms

  • Membrane protein complexes: Evidence suggests cobS anchors a multi-enzyme complex, providing insights into how membrane proteins organize metabolic pathways

  • Membrane stress responses: The PspA response to cobS overexpression offers a model for studying membrane stress signaling pathways

  • Protein-lipid interactions: CobS-membrane interactions can inform understanding of how membrane proteins influence lipid organization and membrane properties

What mutagenesis approaches are most informative for cobS structure-function studies?

Strategic mutagenesis can provide valuable insights:

  • Catalytic residues: The D82A mutation has been demonstrated to inactivate cobS while maintaining membrane association, allowing separation of structural and catalytic effects

  • Transmembrane domain alterations: Mutations in transmembrane regions can help define how cobS integrates into and influences membrane structure

  • Conserved motifs: Targeting evolutionarily conserved sequences across bacterial and archaeal cobS homologs can identify functionally critical regions

  • Interface residues: Mutations at potential protein-protein interaction sites may disrupt the formation of multi-enzyme complexes, helping map the cobamide biosynthesis interactome

These approaches should be combined with activity assays and membrane effect measurements to comprehensively characterize structure-function relationships.

How does Nocardioides sp. cobS compare with cobS from other bacterial species?

While specific comparative data for Nocardioides sp. cobS is limited in the provided search results, general observations about cobS conservation include:

  • Sequence conservation: CobS proteins are highly conserved across species that synthesize cobamides de novo, with polytopic membrane association being a universal feature

  • Functional conservation: The enzymatic role of cobS in catalyzing the penultimate step of cobamide biosynthesis is maintained across species

  • Structural features: All cobS proteins share the polytopic integral membrane protein architecture essential for their function

  • E. coli and S. enterica homology: For context, E. coli and S. enterica cobS genes show 83% identity and 93% similarity at the sequence level

Nocardioides sp. cobS likely maintains these core characteristics while potentially having species-specific adaptations that would require detailed comparative biochemical analysis.

What is known about the interaction between cobS and cobC in the cobalamin biosynthesis pathway?

Research has revealed several important aspects of the cobS-cobC relationship:

  • Sequential enzymatic activity: CobS catalyzes the formation of AdoCbl-P, which then serves as the substrate for CobC phosphatase to produce the final AdoCbl product

  • Physical interaction: In vitro evidence demonstrates that CobC association with liposomes depends on the presence of cobS, suggesting direct physical interaction

  • Functional synergy: Coexpression of cobC with cobS counteracts the detrimental membrane effects of cobS overexpression, improving cell viability

  • Complex formation: Evidence supports the hypothesis that cobS serves as an anchor for a multi-enzyme complex that includes cobC to catalyze the late steps of CoB12 biosynthesis

This interaction represents a model for how membrane-associated and soluble enzymes coordinate to complete metabolic pathways, with potential implications for understanding other membrane-associated biosynthetic processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.