Recombinant Nocardioides sp. NADH-quinone oxidoreductase subunit K (nuoK)

What is Nocardioides sp. NADH-quinone oxidoreductase subunit K (nuoK)?

Nocardioides sp. NADH-quinone oxidoreductase subunit K (nuoK) is a protein subunit of the NADH dehydrogenase complex (also known as complex I) in the bacterial respiratory chain. This protein is encoded by the nuoK gene (Noca_0530) in Nocardioides sp. strain BAA-499/JS614. The protein functions as part of the electron transport chain, contributing to energy metabolism in these bacterial cells. Alternative names for this protein include NADH dehydrogenase I subunit K and NDH-1 subunit K, with the EC number 1.6.99.5, indicating its role in oxidoreduction reactions . The amino acid sequence of this protein is defined as MNVTAYVVLSGILFTIGCVGVLIRRNAIVVFMCVELMLNASNLALVAFARQHGNLDGQIAAFFVMVVAAAEVVVGLAIIMTIFRTRRSASVDDASLLKY .

What expression systems are available for producing recombinant nuoK protein?

Recombinant nuoK protein from Nocardioides sp. can be produced using multiple expression systems, each offering different advantages depending on research requirements. Currently available systems include:

• Yeast expression system - suitable for eukaryotic post-translational modifications

• E. coli expression system - preferred for high yield and economic production

• Baculovirus expression system - offers insect cell-based expression with complex folding capabilities

• Mammalian cell expression system - provides the most native-like post-translational modifications

For specialized applications, the protein can also be produced with specific tags, including in vivo biotinylation using AviTag-BirA technology, which catalyzes an amide linkage between biotin and a specific lysine residue in the AviTag peptide . The choice of expression system should be determined by downstream applications, required yield, and whether post-translational modifications are critical to the research question.

How should recombinant nuoK protein be stored and handled?

For optimal stability and activity, recombinant nuoK protein should be stored following these guidelines:

• The lyophilized protein powder should be briefly centrifuged before opening to ensure all material is at the bottom of the vial.

• Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

• For short-term storage (up to one week), working aliquots can be kept at 4°C.

• For long-term storage, keep at -20°C, and for extended preservation, store at -80°C .

Repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and activity. The storage buffer typically consists of a Tris-based buffer with 50% glycerol, optimized specifically for this protein . When handling the protein, it's advisable to work quickly at controlled temperatures to minimize degradation and maintain functional integrity.

What are the implications of mutations in the nuoK gene for complex I assembly and function?

Mutations in nuoK genes can have significant consequences for complex I assembly and function, potentially disrupting the electron transport chain and cellular energy metabolism. Drawing parallels from studies on E. coli complex I, where genetic analyses have shown that mutations in nuo genes can affect both the expression and assembly of the entire complex , it is reasonable to predict similar effects for nuoK mutations in Nocardioides sp.

Based on E. coli studies, mutations in membrane subunits like nuoK might lead to:

• Impaired complex I assembly

• Reduced NADH dehydrogenase activity

• Compromised proton translocation efficiency

• Altered cellular respiration capacity

In the E. coli model, researchers have constructed isogenic collections of nuo mutants to study the physiological, biochemical, and molecular consequences of defects in various Nuo subunits . A similar approach could be applied to study nuoK in Nocardioides sp., potentially using site-directed mutagenesis to introduce specific modifications to the gene. Studies in E. coli have shown that even relatively small alterations, such as the 235-bp deletions or duplications created in the nuoG subunit, can have significant functional consequences .

How does the nuoK subunit from Nocardioides sp. compare with homologous proteins from other bacterial species?

The nuoK subunit from Nocardioides sp. shares functional similarities with homologous proteins from other bacterial species, though with distinct structural features reflecting evolutionary adaptations. Comparison with the well-studied E. coli system provides valuable insights:

The nuoK subunit is part of the minimal form of the type I NADH dehydrogenase in bacteria like E. coli, which has become a model system for identifying and characterizing the mechanisms by which cells regulate the synthesis and assembly of this large respiratory complex . Nocardioides, as a Gram-positive actinobacterium, may have evolved specific adaptations in its complex I components, including nuoK, to suit its ecological niche and metabolic requirements.

What are the optimal conditions for expressing recombinant nuoK protein in E. coli?

When expressing recombinant nuoK protein in E. coli, researchers should optimize several parameters to ensure high yield and proper folding of this membrane protein:

• Expression strain selection: Consider BL21(DE3) or C41(DE3)/C43(DE3) strains, with the latter specialized for membrane protein expression.

• Expression vector: Use vectors with tunable promoters such as T7 or tac to control expression levels. For this hydrophobic membrane protein, moderate expression is often preferable to prevent aggregation.

• Induction parameters:

  • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

  • Inducer concentration: Start with lower IPTG concentrations (0.1-0.5 mM)

  • Duration: Extended expression times (16-24 hours) at lower temperatures

• Media composition:

  • Rich media (such as 2XYT or TB) supplemented with glucose (0.5-1%)

  • Consider auto-induction media for controlled induction

• Purification strategy:

  • Use detergents compatible with membrane proteins (DDM, LDAO, etc.)

  • Include glycerol (10-20%) in buffers to stabilize the protein

  • Consider purification under native conditions to maintain protein structure

Based on biotechnology approaches used for similar proteins, the inclusion of solubility-enhancing tags (such as MBP or SUMO) may improve the yield of correctly folded protein. When working with nuoK specifically, the high hydrophobicity of the protein necessitates careful handling to prevent aggregation during expression and purification .

How can researchers verify the functional activity of purified recombinant nuoK?

Verifying the functional activity of purified recombinant nuoK requires a combination of biochemical and biophysical approaches to assess both its individual properties and its capacity to integrate into the larger complex I structure:

• NADH oxidation assay: Measure NADH dehydrogenase activity using artificial electron acceptors such as ferricyanide or dichlorophenolindophenol (DCPIP). Though nuoK alone would not show this activity, it can be reconstituted with other subunits.

• Reconstitution experiments: Combine purified nuoK with other purified complex I subunits to reconstitute partial or full complex activities.

• Proteoliposome incorporation: Reconstitute nuoK into proteoliposomes to assess membrane integration and potential proton translocation capability when combined with other subunits.

• Binding studies: Use surface plasmon resonance (SPR) or other binding assays to verify interactions with known partner subunits within complex I.

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to verify secondary structure elements

  • Limited proteolysis to assess proper folding

  • Size-exclusion chromatography to evaluate oligomeric state

These functional assays should be complemented with quality control methods such as SDS-PAGE (>85% purity) and Western blotting with specific antibodies if available . For complete functional assessment, reconstitution of nuoK with partner subunits is essential, as the individual subunit likely has limited activity outside the context of the assembled complex.

What approaches can be used to study protein-protein interactions between nuoK and other complex I subunits?

Several complementary approaches can be employed to investigate protein-protein interactions between nuoK and other complex I subunits:

• Co-immunoprecipitation (Co-IP): Using antibodies against nuoK or epitope tags to pull down interacting partners, followed by identification via mass spectrometry or Western blotting.

• Crosslinking coupled with mass spectrometry: Chemical crosslinkers can capture transient interactions, with subsequent mass spectrometry analysis identifying interaction sites and partners.

• Yeast two-hybrid (Y2H) assays: For detecting binary interactions, though this may be challenging for membrane proteins like nuoK.

• Split-protein complementation assays: Such as bimolecular fluorescence complementation (BiFC) or split luciferase assays to visualize interactions in cellular contexts.

• Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between nuoK and potential partner subunits.

• Microscale thermophoresis (MST): To detect interactions based on changes in thermophoretic mobility upon binding.

• Genetic approaches: Similar to those used in E. coli studies, where researchers constructed isogenic collections of nuo mutants to study interactions indirectly through phenotypic analysis .

For membrane proteins like nuoK, specialized approaches may be necessary. Detergent-solubilized proteins or nanodiscs can be used to maintain the native conformation while enabling interaction studies. For mapping the broader interaction network within complex I, approaches like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable structural insights into interaction interfaces between nuoK and other subunits.

What are common problems encountered during recombinant nuoK expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant nuoK protein due to its hydrophobic nature and membrane-associated characteristics:

• Protein aggregation and inclusion body formation

  • Problem: Overexpression leading to improper folding and aggregation

  • Solution: Reduce expression temperature (16-20°C), decrease inducer concentration, use specialized E. coli strains (C41/C43), or add solubilizing agents like glycerol to the growth medium

• Low expression levels

  • Problem: Poor translation or rapid degradation of the expressed protein

  • Solution: Optimize codon usage for the expression host, use protease-deficient strains, add protease inhibitors during extraction, or try alternative expression systems like baculovirus

• Protein instability after purification

  • Problem: Rapid degradation or loss of structural integrity

  • Solution: Optimize buffer composition (add stabilizers like glycerol), avoid repeated freeze-thaw cycles, store in aliquots at -80°C for long-term storage

• Poor membrane integration

  • Problem: Improper insertion into membranes during expression

  • Solution: Include mild detergents during extraction, consider cell-free expression systems with lipid nanodiscs or liposomes

• Tag interference with function

  • Problem: Protein tags affecting structure or function

  • Solution: Compare different tag positions (N- vs C-terminal), use cleavable tags, or optimize tag selection based on the specific experimental requirements

A systematic approach to troubleshooting involves testing multiple expression conditions in parallel small-scale cultures before scaling up to production levels. Additionally, fusion partners like MBP or SUMO can sometimes enhance solubility and proper folding of challenging membrane proteins like nuoK.

How can researchers assess the purity and integrity of recombinant nuoK preparations?

A comprehensive quality control workflow for recombinant nuoK should include multiple analytical techniques to assess purity, integrity, and homogeneity:

• SDS-PAGE analysis

  • Standard method to assess protein purity (target >85% purity)

  • Both Coomassie and silver staining should be employed for complete visualization

  • Western blotting with anti-nuoK or anti-tag antibodies to confirm identity

• Mass spectrometry

  • Intact mass analysis to confirm correct molecular weight and post-translational modifications

  • Peptide mapping (LC-MS/MS) after protease digestion to verify sequence coverage and identify potential modifications or degradation products

• Size exclusion chromatography (SEC)

  • Assess homogeneity and oligomeric state

  • Detect potential aggregation or degradation products

  • Can be coupled with multi-angle light scattering (SEC-MALS) for precise molecular weight determination

• Circular dichroism (CD) spectroscopy

  • Evaluate secondary structure content

  • Monitor protein folding and stability under different conditions

• Thermal shift assays

  • Assess protein stability and identify stabilizing buffer conditions

  • Monitor unfolding transitions to evaluate batch-to-batch consistency

• Dynamic light scattering (DLS)

  • Measure particle size distribution to detect aggregation

  • Assess sample polydispersity

For membrane proteins like nuoK, additional techniques such as detergent screening via limited proteolysis or fluorescence-detection size exclusion chromatography (FSEC) may provide valuable information about protein stability in different detergent environments. Integration of multiple quality control methods ensures comprehensive assessment of protein quality before proceeding to functional studies.

What factors affect the stability of nuoK protein during storage and experimental procedures?

Several critical factors influence the stability of nuoK protein during storage and experimental use:

• Temperature conditions

  • Storage: Store at -20°C for regular use, or -80°C for extended preservation

  • Working conditions: Maintain at 4°C during experiments to minimize degradation

  • Avoid: Repeated freeze-thaw cycles that promote protein denaturation and aggregation

• Buffer composition

  • pH stability range: Optimal pH is typically between 7.0-8.0 for most bacterial proteins

  • Salt concentration: Moderate ionic strength (150-300 mM NaCl) typically enhances stability

  • Additives: 50% glycerol significantly improves storage stability

  • Reducing agents: May be necessary to prevent oxidation of cysteine residues

• Protein concentration effects

  • High concentrations: May promote aggregation for hydrophobic membrane proteins like nuoK

  • Low concentrations: May lead to adsorption to container surfaces and apparent loss

  • Optimal range: Typically 0.1-1.0 mg/mL for reconstitution from lyophilized powder

• Container material interactions

  • Surface adsorption: Use low-binding tubes (polypropylene) to minimize protein loss

  • Light exposure: Store in amber containers or wrapped in foil if photosensitive

• Handling considerations

  • Mechanical stress: Minimize excessive vortexing or vigorous pipetting

  • Contamination: Use sterile techniques to prevent microbial growth and protease contamination

For reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial before opening to bring the contents to the bottom, then reconstitute in deionized sterile water to the appropriate concentration . Working aliquots can be stored at 4°C for up to one week, but longer storage requires freezing under optimal conditions .

How does the nuoK subunit compare between different species of Nocardioides?

The nuoK subunit shows both conservation and variation across different Nocardioides species, reflecting the evolutionary adaptations of this respiratory complex component:

Nocardioides species generally maintain high G+C content in their genomic DNA (approximately 71.9% in N. ungokensis), which likely influences codon usage in the nuoK gene . This high G+C content is characteristic of actinobacteria and may affect protein expression strategies when producing recombinant nuoK.

What experimental approaches can be used to study the role of nuoK in electron transport and proton pumping?

Several sophisticated experimental approaches can elucidate the specific role of nuoK in electron transport and proton pumping mechanisms:

• Site-directed mutagenesis studies

  • Create targeted mutations in conserved residues of nuoK

  • Assess effects on complex I assembly and function

  • Similar approaches have been successful in E. coli nuo studies, where researchers created specific deletions and duplications to study functional consequences

• Reconstitution systems

  • Reconstitute purified nuoK with other complex I subunits in liposomes

  • Measure proton pumping using pH-sensitive dyes or electrodes

  • Assess electron transport with artificial electron donors/acceptors

• Biophysical characterization

  • Electron paramagnetic resonance (EPR) spectroscopy to study electron transfer

  • Solid-state NMR to examine structural details in membrane environment

  • Cryo-electron microscopy for structural analysis within the intact complex

• Genetic complementation experiments

  • Express Nocardioides nuoK in E. coli or other bacterial nuoK mutants

  • Assess restoration of complex I function and proton pumping

  • Compare wild-type and mutant versions for functional complementation

• Proton translocation assays

  • Measure pH changes in proteoliposomes containing reconstituted complex I

  • Use fluorescent probes to monitor membrane potential generation

  • Assess the stoichiometry of proton translocation per electron pair

How can structural studies of nuoK contribute to understanding bacterial respiratory complexes?

Structural studies of nuoK can provide critical insights into bacterial respiratory complexes and their evolutionary significance:

• Membrane protein structural biology applications

  • nuoK represents an important class of membrane proteins in bacterial respiratory chains

  • Structural determination methods (X-ray crystallography, cryo-EM, NMR) can reveal transmembrane organization

  • Structural features can illuminate proton translocation mechanisms

• Integration with whole complex I structure

  • Position and orientation of nuoK within the larger complex I

  • Interaction interfaces with adjacent subunits

  • Potential conformational changes during the catalytic cycle

• Evolutionary conservation analysis

  • Comparison with homologous subunits across bacterial phyla

  • Identification of conserved residues critical for function

  • Mapping of species-specific adaptations onto structural framework

• Structure-guided drug design applications

  • Potential antimicrobial targets against pathogenic species

  • Binding pockets for inhibitors or modulators

  • Structure-activity relationships for respiratory chain inhibitors

• Bioenergetic mechanism investigations

  • Proton translocation pathways through the membrane domain

  • Coupling mechanism between electron transfer and proton pumping

  • Energy transduction efficiency determinants

Structural studies of nuoK would complement the genetic approaches used in E. coli, where researchers have identified the essential role of various subunits in complex I function . Understanding the structural basis of nuoK function would provide mechanistic insights into how bacterial respiratory complexes convert redox energy into the proton gradient that drives ATP synthesis, offering fundamental knowledge about bacterial energy metabolism with potential applications in antimicrobial development.