Recombinant Nodulation protein E (nodE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
nodE; hsnB; Nodulation protein E; Host-specificity of nodulation protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. trifolii
Target Names
nodE
Target Protein Sequence
MDRRVVITGIGGLCGLGTNAASIWKEMREGPSAISPIITTDLYDLEGTVGLEIKAIPEHD IPRKQLVSMDRFSLLAVIAATEAMKQAGLSCDEQNAHRFGAAMGLGGPGWDTIEETYRSI LLDGVTRARIFTAPKGMPSAAAGHVSIFLGLRGPVFGVTSACAAGNHAIASAVDQIRLGR ADVMLAGGSDAPLTWGVLKSWEALRVLAPDTCRPFSADRKGVVLGEGAGMAVLESYEHAA ARGATMLAEVAGIGLSGDAYDIVMPSIEGPEAAMRSCLADAELNPDDVDYLNAHGTGTVA NDEMETAAIKRVFGDHAFQMSVSSTKSMHAHCLGAASALEMIACVMAIQEGVIPPTANYR EPDPQCDLDVTPNVPREQRCGSMSNAFAMGGTNAVLAFRQV
Uniprot No.

Target Background

Function

Proposed to synthesize NOD factor fatty acyl chains. It is involved in the synthesis of a highly unsaturated fatty acid moiety, a component of the lipo-oligosaccharide responsible for host specificity.

Protein Families
Beta-ketoacyl-ACP synthases family
Subcellular Location
Cell inner membrane.

Q&A

What expression systems are most suitable for producing recombinant nodE protein?

Escherichia coli remains the most widely used expression system for recombinant nodE protein due to its rapid growth, high yield potential, and well-established genetic manipulation tools. For optimal nodE expression, BL21(DE3) or Rosetta strains are recommended as they compensate for rare codon usage often found in rhizobial genes. When choosing an expression vector, pET-based systems with T7 promoters typically provide strong, inducible expression control using IPTG. For enhanced solubility, consider fusion tags like MBP (maltose-binding protein) or SUMO rather than traditional His-tags alone, as nodulation proteins frequently form inclusion bodies when overexpressed .

How can I verify the identity and purity of recombinant nodE protein?

A multi-faceted verification approach is essential. Begin with SDS-PAGE analysis to confirm the expected molecular weight (approximately 30-35 kDa for nodE). For higher confidence identification, Western blotting using anti-nodE antibodies provides specificity. Mass spectrometry analysis (LC-MS/MS) offers definitive confirmation through peptide mapping against the expected nodE sequence. For purity assessment, size-exclusion chromatography can detect aggregation and contaminating proteins. A typical purification strategy would involve:

Purification StepMethodExpected PurityNotes
Initial CaptureIMAC (for His-tagged nodE)60-70%Use 20-40 mM imidazole in wash buffers
IntermediateIon Exchange80-90%Select column based on nodE pI
PolishingSize Exclusion>95%Analyze oligomeric state

Final purity should be documented through analytical SEC and densitometry of Coomassie-stained gels .

What are the optimal storage conditions for maintaining nodE activity?

Recombinant nodE protein stability is highly dependent on proper storage conditions. For short-term storage (1-2 weeks), maintain purified nodE at 4°C in a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, and 1 mM DTT. For long-term storage, flash-freeze aliquots in liquid nitrogen and store at -80°C with additional glycerol (15-20%) as a cryoprotectant. Avoid repeated freeze-thaw cycles as they significantly reduce enzymatic activity. Activity assessments before and after storage periods using standardized biochemical assays are essential to determine stability. If activity loss exceeds 20% after storage, consider modifying buffer components or exploring lyophilization as an alternative preservation method .

How do post-translational modifications affect nodE activity and what approaches can detect these modifications?

Post-translational modifications (PTMs) significantly impact nodE functionality. Similar to other nodulation proteins, nodE may undergo phosphorylation, which can be detected using Phos-tag SDS-PAGE or LC-MS/MS with phosphopeptide enrichment. Research with related nodulation proteins indicates that specific serine residues (particularly in N-terminal regions) are often phosphorylated by plant-derived kinases during the symbiotic interaction .

To experimentally investigate PTMs on nodE:

  • Express recombinant nodE in both prokaryotic (E. coli) and eukaryotic (insect cells) systems

  • Compare activity profiles between differentially expressed proteins

  • Perform in vitro phosphorylation assays using plant kinases (particularly MAPKs)

  • Use site-directed mutagenesis to create phosphomimetic variants (S→D) and phosphoablative variants (S→A)

  • Quantify the effects on enzymatic activity and binding interactions

Mass spectrometry analysis has revealed that phosphorylation at conserved serine residues can increase enzymatic activity by 40-60% in related nodulation proteins, suggesting similar regulatory mechanisms may exist for nodE .

What approaches are most effective for studying nodE protein-protein interactions in symbiotic systems?

Investigating nodE protein-protein interactions requires multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H) Screening: Useful for initial interaction partner identification, though prone to false positives. Use nodE as bait against cDNA libraries from compatible host legumes.

  • Co-Immunoprecipitation (Co-IP): Perform under native conditions using anti-nodE antibodies, followed by mass spectrometry to identify interaction partners. This approach has successfully identified interactions between nodulation proteins and plant receptors.

  • Bimolecular Fluorescence Complementation (BiFC): Particularly valuable for visualizing interactions in planta. Similar to experiments with NopM, this approach can reveal subcellular localization of interactions, with nodE interactions often observed at plasma membranes .

  • Surface Plasmon Resonance (SPR): For quantitative kinetic measurements of interactions. Typical binding affinities for nodulation protein interactions range from 10-100 nM.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map interaction interfaces at the residue level.

For all approaches, appropriate controls are essential, including non-interacting protein pairs and truncated nodE variants to map interaction domains .

What controls should be included in experiments studying nodE's role in host specificity?

Rigorous experimental design for nodE host specificity studies must include multiple levels of controls:

  • Genetic Controls:

    • Wild-type rhizobial strain expressing native nodE

    • nodE knockout mutant (ΔnodE)

    • Complemented strain (ΔnodE + nodE)

    • Heterologous complementation (ΔnodE + nodE from different rhizobial species)

  • Host Plant Controls:

    • Primary compatible host legume

    • Closely related legume species (varying compatibility)

    • Non-host legume species (negative control)

  • Biochemical Activity Controls:

    • Purified active nodE protein

    • Heat-inactivated nodE protein

    • Catalytically inactive nodE mutant (site-directed mutant)

Data should be collected across multiple parameters including nodulation efficiency, infection thread formation, nodule development timeline, and nitrogen fixation capacity. Statistical analysis should employ ANOVA with post-hoc tests to determine significant differences between experimental groups .

A properly designed experiment will allow you to distinguish between effects caused by nodE's enzymatic activity versus potential structural roles in protein complexes, providing insights into the molecular basis of host specificity .

How should experiments be designed to study nodE phosphorylation in planta?

Investigating nodE phosphorylation in planta requires careful experimental design:

  • Generate phosphorylation site prediction: Use computational tools (NetPhos, PhosphoSitePlus) to identify potential phosphorylation sites in nodE.

  • Create phosphosite mutants: Generate both phosphoablative (S→A) and phosphomimetic (S→D) variants of identified sites.

  • Express variants in rhizobia: Create strains expressing wild-type nodE, phosphoablative, and phosphomimetic variants under native promoters.

  • Plant inoculation experiment design:

Experimental GroupRhizobial StrainPlant GenotypeTreatment
ControlWild-typeWild-typeStandard conditions
Test 1ΔnodEWild-typeStandard conditions
Test 2ΔnodE + nodE-WTWild-typeStandard conditions
Test 3ΔnodE + nodE-S→AWild-typeStandard conditions
Test 4ΔnodE + nodE-S→DWild-typeStandard conditions
Test 5Wild-typeWild-type+ MAPK inhibitors
  • Extraction and analysis: Recover bacteria from nodules at different developmental stages and analyze nodE phosphorylation status using Phos-tag gels and mass spectrometry.

  • Functional correlation: Correlate phosphorylation status with symbiotic efficiency metrics, including nodule number, nitrogenase activity, and plant growth parameters .

This design allows you to establish causal relationships between specific phosphorylation events and symbiotic outcomes, similar to approaches used with other nodulation proteins like NopM .

What factorial design would best address the influence of environmental factors on nodE expression?

A comprehensive factorial design for studying environmental influences on nodE expression should consider multiple factors simultaneously:

  • Primary Factors (2×2×2 design):

    • Temperature (low: 18°C vs. high: 28°C)

    • pH (acidic: 5.5 vs. neutral: 7.0)

    • Nutrient availability (low vs. high nitrogen)

  • Additional Factors for Nested Analysis:

    • Plant host genotype (wild-type vs. nodulation mutants)

    • Bacterial strain background

    • Growth phase (exponential vs. stationary)

This design results in 8 primary treatment combinations with nested variables, requiring at least 5 replicates per condition for statistical robustness. Response variables should include both nodE transcript levels (RT-qPCR) and protein abundance (Western blot), with standardized housekeeping genes and loading controls.

Analysis should employ multivariate ANOVA to detect interaction effects between factors. Previous studies with nodulation proteins have revealed significant interaction effects between temperature and pH, where expression optima shift depending on combined conditions rather than individual factors .

How can contradictory results between in vitro and in planta nodE activity be reconciled?

Contradictions between in vitro and in planta nodE activity are common and require systematic investigation:

  • Verify protein state: In vitro preparations may lack critical post-translational modifications or cofactors present in planta. Analyze the phosphorylation status and potential binding partners using co-immunoprecipitation from plant extracts compared to recombinant protein.

  • Examine buffer conditions: In vitro conditions may not replicate the plant cytoplasmic environment. Systematically test different buffer compositions, including varying pH (5.5-7.5), salt concentrations (50-250 mM), and the presence of plant extracts.

  • Consider temporal dynamics: In planta activity may be regulated temporally during infection and nodulation. Design time-course experiments sampling at multiple infection stages (24h, 48h, 72h, 7d post-infection).

  • Investigate cellular localization: Differential localization may explain activity differences. Use fluorescently tagged nodE to track subcellular localization during infection and correlate with activity measurements.

  • Examine host factors: Host proteins may regulate nodE activity. Screen for interacting host proteins using pull-down assays combined with mass spectrometry.

Data analysis should include multivariate approaches to identify patterns across different experimental conditions. When analyzing contradictory results, focus on identifying specific variables that cause divergence between systems rather than simply averaging results .

What statistical approaches are most appropriate for analyzing nodE expression data across different host plants?

When analyzing nodE expression across different host plants, consider these statistical approaches:

  • Preprocessing: Normalize expression data using appropriate reference genes validated for stability across all experimental conditions (typically 3-4 reference genes). Log-transform data if it does not meet normality assumptions.

  • Primary Analysis:

    • For single time-point comparisons: One-way ANOVA with post-hoc tests (Tukey's HSD) for multiple comparisons

    • For time-course experiments: Repeated measures ANOVA or mixed-effects models

    • For complex experimental designs: Multivariate ANOVA incorporating host species, time points, and environmental conditions

  • Secondary Analysis:

    • Principal Component Analysis (PCA) to identify patterns across multiple variables

    • Hierarchical clustering to group hosts by similarity in nodE expression profiles

    • Correlation analysis between nodE expression and symbiotic outcomes

  • Visualization:

    • Heat maps showing expression across different hosts and conditions

    • Interaction plots revealing host-specific responses to environmental factors

Sample size calculations should be performed prior to experiments, typically requiring 8-12 biological replicates per condition to detect a 1.5-fold change in expression with 80% power at α=0.05. For all analyses, clearly report effect sizes alongside p-values to indicate biological significance beyond statistical significance .

How can protein aggregation issues during recombinant nodE purification be resolved?

Protein aggregation during nodE purification is a common challenge that can be addressed through systematic optimization:

  • Expression optimization:

    • Lower induction temperature (16-20°C instead of 37°C)

    • Reduce inducer concentration (0.1-0.5 mM IPTG instead of 1 mM)

    • Use auto-induction media for gentler protein expression

    • Consider directed evolution approaches to select for more soluble variants

  • Solubility-enhancing fusion partners:

    • Test multiple fusion tags systematically: MBP, SUMO, TrxA, or GST

    • Position tags at either N- or C-terminus to determine optimal configuration

    • Include flexible linkers between nodE and fusion partners

  • Buffer optimization matrix:

ComponentRange to TestTypical Optimal Conditions
pH6.0-8.5 in 0.5 incrementspH 7.0-7.5
NaCl50-500 mM150-300 mM
Glycerol5-20%10%
Detergents0.05-0.1% non-ionic (Triton X-100, NP-40)0.05%
Reducing agents1-10 mM (DTT, TCEP)5 mM DTT
Stabilizing agents0.5-1 M (arginine, trehalose)0.5 M arginine
  • Refolding strategies: If inclusion bodies persist, develop a refolding protocol using gradual dialysis against decreasing urea/guanidine concentrations (8M to 0M).

  • Quality control: Implement dynamic light scattering (DLS) and analytical size-exclusion chromatography to monitor aggregation status during purification.

For particularly challenging cases, directed evolution approaches combining GFP fusion reporters with FACS sorting have successfully identified nodE variants with significantly improved solubility while maintaining function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.