Recombinant Nomascus concolor Melanocyte-stimulating hormone receptor (MC1R)

What is Recombinant Nomascus concolor MC1R and what is its biological significance?

Recombinant Nomascus concolor MC1R is a laboratory-produced version of the melanocyte-stimulating hormone receptor found in Black crested gibbons (Hylobates concolor). This G protein-coupled receptor plays a crucial role in regulating melanin production and pigmentation in mammalian species.

The full protein consists of 317 amino acids with several transmembrane domains characteristic of G protein-coupled receptors. The amino acid sequence includes: MAVQGFQRRLLGSLNSTPTAIPQLRLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVVAAIAKNRNLHSPTYCFICCLALSDLLVSGGNVLETVVILLLEASALAARAAVVQQLDNVIDVITCSSMVSSLCFLGAIAVDRHVSIFYALRYHSIVTLPRARQAIAAIWVASVLFSALFIAYCDHAA VLLCLVVFFL AMLVLMAVLYVHMLARA CQHAQGIAQLHKRQRPLHQGFGLKGAVTLSILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAFRRQELRRTLKEVLTCSW .

Studying this receptor in Nomascus concolor provides valuable insights into evolutionary adaptations of pigmentation systems in primates, particularly across different gibbon genera, which experienced rapid radiation approximately 5 million years ago .

How does the structure of Nomascus concolor MC1R compare to MC1R in other primates?

While the search results don't provide a direct comparison between Nomascus concolor MC1R and other primate MC1R structures, we can infer from gibbon genomic studies that there is likely evolutionary conservation of functional domains combined with species-specific variations. The gibbon genera (Nomascus, Hylobates, Hoolock, and Symphalangus) experienced a near-instantaneous radiation approximately 5 million years ago, coinciding with major geographical changes in Southeast Asia . This radiation may have influenced functional adaptations in pigmentation-related genes including MC1R.

What expression systems are typically used to produce recombinant Nomascus concolor MC1R?

While the search results don't specify the exact expression system used for producing the recombinant Nomascus concolor MC1R described in result , typical expression systems for mammalian G protein-coupled receptors like MC1R include:

• Bacterial expression systems (E. coli) - Often used for producing receptor fragments or domains

• Insect cell expression systems (Sf9, Sf21, High Five) - Provide better post-translational modifications than bacterial systems

• Mammalian cell expression systems (HEK293, CHO) - Offer the most authentic post-translational modifications and protein folding

The recombinant protein described in the search results is supplied at 50 μg quantity in Tris-based buffer with 50% glycerol optimized for protein stability . The expression region encompasses amino acids 1-317, representing the full-length protein .

How can researchers effectively design functional assays to study ligand interactions with Nomascus concolor MC1R?

Designing functional assays for studying ligand interactions with Nomascus concolor MC1R requires careful consideration of receptor biology and appropriate assay systems:

• Ligand Binding Assays:

  • Radioligand binding assays using labeled α-MSH or synthetic MC1R agonists

  • Competition binding assays to determine binding affinities of various ligands

  • FRET or BRET-based binding assays for real-time monitoring of ligand-receptor interactions

• Signal Transduction Assays:

  • cAMP accumulation assays (MC1R activates adenylyl cyclase pathway)

  • MAPK phosphorylation assays

  • β-arrestin recruitment assays

• Functional Outputs:

  • Melanin production assays when expressed in melanocytes

  • Gene expression analysis of downstream targets

When designing these assays, researchers should consider that MC1R variants can significantly impact receptor function. Studies on human MC1R have classified variants as either pseudoalleles (no impact on function), "r" alleles (partial loss of function), or complete loss-of-function variants . Similar functional classifications may be applicable when studying natural or introduced variations in Nomascus concolor MC1R.

What approaches can be used to investigate the evolutionary significance of MC1R variations between Nomascus concolor and other gibbon species?

Investigating the evolutionary significance of MC1R variations between Nomascus concolor and other gibbon species requires a multi-faceted approach:

• Comparative Genomic Analysis:

  • Sequence analysis across all four gibbon genera (Nomascus, Hylobates, Hoolock, and Symphalangus)

  • Phylogenetic tree construction specifically for MC1R sequences

  • Analysis of selection pressures using dN/dS ratios to identify sites under positive selection

• Population Genetics:

  • Sampling MC1R variation across different populations of Nomascus concolor

  • Analysis of genetic diversity statistics and tests for selection

  • Population structure analysis, particularly relevant considering the fragmented population of approximately 1300 individuals remaining

• Phenotype-Genotype Correlations:

  • Correlation of MC1R variants with pigmentation patterns across gibbon species

  • Analysis of MC1R variation in relation to habitat differences and potential adaptive significance

The rapid radiation of gibbon genera approximately 5 million years ago provides an interesting evolutionary context for studying MC1R variation. This radiation coincided with major geographical changes in Southeast Asia that caused cycles of habitat compression and expansion, potentially driving adaptations in pigmentation genes.

Analysis methods similar to those used in human MC1R studies can be applied, including Hardy-Weinberg equilibrium testing, calculation of odds ratios, and tests for heterogeneity across populations .

What methodological considerations are important when developing MC1R-targeted imaging approaches for Nomascus concolor research?

Developing MC1R-targeted imaging approaches for Nomascus concolor research requires careful consideration of receptor biology, ligand specificity, and imaging technologies:

• Tracer Development:

  • Design of high-affinity, selective ligands for Nomascus concolor MC1R

  • Optimization of pharmacokinetic properties for in vivo applications

  • Selection of appropriate imaging modalities (PET, SPECT, optical)

• Validation Approaches:

  • Correlation of imaging signals with MC1R expression confirmed by immunohistochemistry

  • In vitro binding assays to confirm specificity for Nomascus concolor MC1R

  • Consideration of cross-reactivity with other melanocortin receptors (MC2R-MC5R)

• Translational Considerations:

  • While human studies have used tracers like [203Pb]VMT01 for SPECT/CT imaging and [68Ga]VMT02 for PET/CT imaging , these would need validation for gibbon applications

  • Biodistribution studies to determine optimal imaging timepoints (in human studies, [68Ga]VMT02 PET/CT at 3 hours provided the best tumor-to-background ratio)

Immunohistochemistry should be used as a validation approach to confirm MC1R expression and correlation with imaging findings, similar to the methodology used in human melanoma studies .

What are the optimal storage and handling conditions for working with recombinant Nomascus concolor MC1R?

Proper storage and handling of recombinant Nomascus concolor MC1R is essential for maintaining protein integrity and functionality:

• Storage Recommendations:

  • Store at -20°C for regular storage

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots can be stored at 4°C for up to one week

• Buffer Conditions:

  • The protein is supplied in Tris-based buffer with 50% glycerol, optimized for stability

  • When designing experiments, consider compatibility with this buffer or establish protocols for buffer exchange if necessary

• Handling Practices:

  • Avoid repeated freeze-thaw cycles as this can compromise protein structure and activity

  • Prepare small working aliquots to minimize freeze-thaw events

  • Use appropriate protein concentration determination methods (BCA, Bradford) to verify concentration before experiments

What controls should be included in functional studies of recombinant Nomascus concolor MC1R?

Designing rigorous controls is essential for functional studies of recombinant Nomascus concolor MC1R:

• Positive Controls:

  • Well-characterized MC1R ligands (α-MSH, NDP-MSH)

  • Known functional human MC1R for comparative analysis

  • Positive control cell lines with established MC1R signaling responses

• Negative Controls:

  • Mock-transfected cells lacking MC1R expression

  • Non-functional MC1R mutants (if available)

  • MC1R antagonists to confirm specificity of agonist responses

• Validation Controls:

  • Western blot confirmation of recombinant MC1R expression

  • Verification of correct membrane targeting using subcellular fractionation or imaging

  • For signaling studies, pathway-specific controls (e.g., forskolin for cAMP pathways)

• Experimental Design Considerations:

  • Inclusion of dose-response relationships rather than single concentrations

  • Time-course experiments to capture kinetics of responses

  • Replication across multiple independent experiments

What techniques can be used to analyze MC1R genetic variation in Nomascus concolor populations?

Analysis of MC1R genetic variation in Nomascus concolor populations requires specialized techniques:

• Sample Collection and DNA Extraction:

  • Non-invasive sampling methods are preferred for endangered species like Nomascus concolor

  • Fecal samples, shed hair, or small tissue biopsies can be used

  • Specialized DNA extraction protocols for low-quality samples

• Genotyping Approaches:

  • Direct sequencing of the MC1R coding region

  • PCR-RFLP for known variants

  • Next-generation sequencing for comprehensive variant detection

  • Microsatellite marker analysis for population structure assessment

• Data Analysis Methods:

  • Tests for departure from Hardy-Weinberg equilibrium

  • Calculation of heterozygosity and other genetic diversity metrics

  • Population structure analysis using methods like STRUCTURE

  • Least-cost path analysis and isolation by resistance modeling to understand gene flow patterns

• Comparative Approaches:

  • In similar studies with gibbons, researchers have identified population clusters and subclusters based on genetic data

  • Analysis should account for the fragmented nature of Nomascus concolor populations (approximately 1300 individuals remaining)

How is recombinant Nomascus concolor MC1R being used in comparative evolutionary studies?

Recombinant Nomascus concolor MC1R serves as a valuable tool in comparative evolutionary studies:

• Primate Evolution Research:

  • Comparison of MC1R structure and function across different primate lineages

  • Investigation of selection pressures on MC1R in different environmental contexts

  • Understanding the rapid radiation of gibbon genera that occurred approximately 5 million years ago

• Adaptation Studies:

  • Analysis of MC1R variants in relation to habitat types and pigmentation patterns

  • Investigation of potential parallel evolution with other mammalian lineages

  • Study of molecular signatures of selection in MC1R across gibbon species

• Functional Evolution:

  • Reconstruction of ancestral MC1R sequences to understand functional evolution

  • Comparison of ligand binding and signaling properties across species

  • Investigation of how MC1R function relates to the unique karyotype evolution observed in gibbons

Understanding the evolutionary context of Nomascus concolor MC1R is enhanced by knowledge of the gibbon phylogeny, which includes the four genera Nomascus, Hylobates, Hoolock, and Symphalangus, with evidence of extensive incomplete lineage sorting during their rapid radiation .

What role does MC1R play in conservation genetics of Nomascus concolor?

MC1R can play an important role in conservation genetics of the critically endangered Nomascus concolor:

• Population Genetic Analysis:

  • MC1R variation can contribute to understanding population structure and genetic diversity

  • The current fragmented population of approximately 1300 individuals makes genetic diversity assessment crucial

  • Similar to microsatellite studies, MC1R analysis could help identify population clusters and potential barriers to gene flow

• Adaptive Potential Assessment:

  • MC1R variations may reflect local adaptations important for conservation planning

  • Understanding functional genetic variation can inform reintroduction or breeding programs

  • Analysis of inbreeding effects on functional genes like MC1R

• Habitat Connection Analysis:

  • Similar to research using microsatellite markers, MC1R data could contribute to least-cost path analysis and isolation by resistance modeling

  • These approaches help understand how landscape features affect gene flow among populations

  • For example, studies have shown that Nomascus concolor in Wuliangshan National Nature Reserve avoid high-altitude rhododendron forest in favor of evergreen broadleaf forest

Conservation genetics approaches similar to those used in the comprehensive study of Nomascus concolor using microsatellite markers could be applied to MC1R analysis, providing additional insights for conservation planning.

What are the future research directions for Nomascus concolor MC1R studies?

Several promising research directions exist for future studies of Nomascus concolor MC1R:

• Comprehensive Functional Characterization:

  • Detailed investigation of ligand binding properties and signaling pathways

  • Comparative analysis with MC1R from other gibbon species and primates

  • Structure-function studies to identify key functional domains

• Population-Level Variation Studies:

  • Sampling across the remaining fragmented populations to assess natural variation

  • Analysis of potential adaptive significance of any identified variants

  • Integration with broader conservation genetic approaches

• Applications in Conservation:

  • Development of non-invasive genotyping methods for MC1R

  • Integration of MC1R data with other genetic markers for comprehensive population assessment

  • Connection of MC1R variation with other adaptive traits relevant for conservation

• Evolutionary Studies:

  • Investigation of MC1R evolution in the context of the rapid radiation of gibbon genera

  • Analysis of selection pressures on MC1R across different primate lineages

  • Comparative analysis with signatures of selection in other genes involved in gibbon adaptation, such as those important for forelimb development (TBX5) and connective tissues (COL1A1)