Recombinant Nostoc punctiforme Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Nostoc punctiforme Cytochrome b6-f Complex Iron-Sulfur Subunit (petC)

The recombinant full-length Nostoc punctiforme cytochrome b6-f complex iron-sulfur subunit (petC) protein, is a component of the cytochrome b6-f complex found in the cyanobacterium Nostoc punctiforme . The cytochrome b6-f complex is essential for oxygenic photosynthesis, functioning as the electronic link between Photosystem II and Photosystem I, and generating a transmembrane electrochemical proton gradient that drives ATP synthesis . The petC subunit, also known as the Rieske iron-sulfur protein (RISP), plays a crucial role in electron transfer within this complex .

2.1. N-terminal Acetylation

A notable post-translational modification observed in the Nostoc complex is the N-terminal acetylation of the Rieske iron-sulfur protein (ISP) . Mass spectrometry reveals that the N terminus of the Rieske ISP is partly acetylated, indicated by a spectral peak 42 mass units greater than predicted from the amino acid sequence . Two forms of the Rieske iron-sulfur protein (petC; ISP) have been identified: a smaller species with the initiating Met-1 removed (molecular mass = 19,064.2 Da) and a larger species acetylated at the N terminus (molecular mass = 19,106.6 Da) .

Production and Characterization of Recombinant petC

Recombinant Nostoc punctiforme cytochrome b6-f complex iron-sulfur subunit (petC) is produced in E. coli with an N-terminal His tag . The recombinant protein is available as a lyophilized powder with greater than 90% purity, as determined by SDS-PAGE .

Table 1: Properties of Recombinant petC

PropertyDescription
SourceE. coli
TagHis
Protein LengthFull Length (1-179 amino acids)
FormLyophilized powder
AA SequenceMAQFSESADVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPATGGAGGGTTAKDELGNDVSVTKFLENRNAGDRNLVQGLKGDPTYIVVDSKEAIKDYGINAICTHLGCVVPWNVAENKFKCPCHGSQYDETGKVVRGPAPLSLALAHTNVSDDKIVLTPWTETDFRTGDAPWWS
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended.
Gene NamepetC
SynonymspetC; Npun_R0132; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
UniProt IDB2J3K2

Applications and Significance

Recombinant petC is utilized in various biochemical and biophysical studies aimed at understanding the structure, function, and mechanism of the cytochrome b6-f complex . These studies are crucial for understanding photosynthetic electron transfer and energy conversion. Recombinant petC can be used for:

  • Structural studies: Facilitating X-ray crystallography and cryo-EM to determine high-resolution structures of the cytochrome b6-f complex .

  • Functional assays: Assessing electron transfer rates and mechanisms within the complex .

  • Spectroscopic analyses: Investigating the properties of the Rieske iron-sulfur cluster and its interaction with other redox centers .

  • Antibody production: Generating antibodies for immunological studies of the cytochrome b6-f complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; Npun_R0132; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Target Names
petC
Target Protein Sequence
MAQFSESADVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPATGGAGGGTTAKDEL GNDVSVTKFLENRNAGDRNLVQGLKGDPTYIVVDSKEAIKDYGINAICTHLGCVVPWNVA ENKFKCPCHGSQYDETGKVVRGPAPLSLALAHTNVSDDKIVLTPWTETDFRTGDAPWWS
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what is its functional significance in Nostoc punctiforme?

The Cytochrome b6-f complex is a multisubunit membrane protein complex that carries out electron transfer coupled to proton translocation in photosynthetic organisms. It functions as a dimer with a molecular weight of approximately 220,000 Da . In Nostoc punctiforme, a nitrogen-fixing cyanobacterium belonging to the family Nostocaceae, this complex serves as a critical link in the photosynthetic electron transport chain, connecting Photosystem II and Photosystem I by accepting electrons from plastoquinol and transferring them to plastocyanin or cytochrome c6 . This electron transfer is coupled to proton translocation across the thylakoid membrane, contributing to the generation of a proton motive force that drives ATP synthesis.

What is the subunit composition of the Cytochrome b6-f complex in Nostoc punctiforme?

The Cytochrome b6-f complex in Nostoc punctiforme consists of eight polypeptide subunits organized as a dimer containing 26 transmembrane helices . The monomer unit comprises four large subunits and four small subunits:

  • Large subunits:

    • Cytochrome f (petA gene product)

    • Cytochrome b6 (PetB)

    • Rieske iron-sulfur protein (PetC)

    • Subunit IV (PetD)

  • Small subunits:

    • PetG

    • PetL

    • PetM

    • PetN

The four small subunits may provide structural support, arranged as a "picket fence" at the lateral boundary of the dimer, or perhaps function as "chaperone" peptides that guide the assembly of the complex .

What are the structural and functional characteristics of the PetC subunit?

The PetC subunit, also known as the Rieske iron-sulfur protein, is one of the four major subunits of the Cytochrome b6-f complex. It contains a [2Fe-2S] cluster that plays a crucial role in electron transfer. In the Cytochrome b6-f complex from M. laminosus (closely related to Nostoc), the Rieske iron-sulfur protein has a calculated molecular mass of 19,202 Da and a measured mass of 19,295 Da . This slight difference may be attributed to post-translational modifications.

Functionally, the PetC subunit accepts electrons from the oxidation of plastoquinol at the Qo site of cytochrome b6 and transfers them to cytochrome f, representing a critical step in the electron transport chain of photosynthesis.

How does Nostoc punctiforme serve as a model organism for studying the Cytochrome b6-f complex?

Nostoc punctiforme is an excellent model organism for studying the Cytochrome b6-f complex for several reasons:

  • It is a versatile cyanobacterium that can live either independently or in symbiosis with plants from distinct taxa , providing opportunities to study the complex under different physiological conditions.

  • As a cyanobacterium, it has a relatively simple cellular organization compared to higher plants, yet performs oxygenic photosynthesis similar to plants.

  • Nostoc punctiforme produces three types of differentiated cells: heterocysts (specialized for nitrogen fixation), hormogonia (motile filaments involved in dispersal and symbiotic infection), and akinetes . This cellular differentiation allows researchers to study how the expression and function of photosynthetic complexes, including the Cytochrome b6-f complex, vary across different cell types.

  • The genome of Nostoc punctiforme has been fully sequenced, and various genetic tools are available for its manipulation, facilitating molecular genetic studies.

What are the common methods for isolating and purifying the Cytochrome b6-f complex from Nostoc punctiforme?

While specific methods for isolating the native Cytochrome b6-f complex from Nostoc punctiforme are not detailed in the search results, recombinant expression approaches for individual subunits provide valuable insights. For recombinant production, E. coli is commonly used as an expression system, as demonstrated for the PetD subunit . Purification typically involves:

  • Expression with affinity tags (e.g., His-tag) for easier purification

  • Cell lysis under conditions that preserve protein structure and function

  • Affinity chromatography (e.g., Ni-NTA for His-tagged proteins)

  • Size exclusion or ion exchange chromatography for further purification

  • Storage in appropriate buffers with stabilizing agents (e.g., Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for PetD )

For the intact complex, additional considerations including the use of mild detergents for membrane protein solubilization would be necessary.

How does the structure of PetC in Nostoc punctiforme compare to homologous proteins in other photosynthetic organisms?

Comparative structural analysis reveals that despite evolutionary divergence, the core functional elements of PetC—particularly the [2Fe-2S] cluster binding domain and regions involved in interactions with cytochrome b6 and cytochrome f—remain highly conserved. This conservation underscores the fundamental importance of PetC in electron transfer processes across the photosynthetic lineage.

What experimental approaches are most effective for studying PetC-specific electron transfer mechanisms?

Several sophisticated experimental approaches can be employed to study the electron transfer mechanisms involving PetC:

  • Time-resolved spectroscopy: Techniques such as ultrafast transient absorption spectroscopy can track electron transfer events in real-time, providing insights into the kinetics of electron movement from the [2Fe-2S] cluster of PetC to cytochrome f.

  • Site-directed mutagenesis: Targeted mutations of amino acids near the [2Fe-2S] cluster or at the interface with other subunits can help identify residues critical for electron transfer.

  • EPR spectroscopy: Electron paramagnetic resonance can characterize the electronic properties of the [2Fe-2S] cluster in different oxidation states and in response to different physiological conditions.

  • Electrochemical techniques: Methods such as protein film voltammetry can be used to determine the redox potential of the [2Fe-2S] cluster and how it changes in different environments.

  • Structural studies: X-ray crystallography and cryo-electron microscopy can provide atomic-level insights into the arrangement of cofactors and the protein environment that facilitates electron transfer.

How does the expression and function of PetC vary across different cell types in Nostoc punctiforme?

Nostoc punctiforme's ability to differentiate into specialized cell types (vegetative cells, heterocysts, hormogonia, and akinetes) suggests that photosynthetic components, including PetC, might be differentially regulated across these cell types.

While the search results don't provide specific information about PetC expression patterns, insights can be drawn from studies of other proteins. For example, research on the fructose transporter (Frt) using GFP fluorescence showed high expression in vegetative cells and akinetes, variable expression in hormogonia, and no expression in heterocysts .

For PetC, similar expression patterns might be expected, with potential modifications:

  • Heterocysts: Since heterocysts perform mainly PSI-dependent cyclic electron flow but lack PSII activity to protect the oxygen-sensitive nitrogenase, the role of the Cytochrome b6-f complex might be primarily in cyclic electron transport rather than linear electron flow.

  • Hormogonia: These motile filaments involved in symbiotic infection might exhibit altered expression of photosynthetic components to accommodate their specialized role and higher energy demands for motility.

  • Akinetes: These resting cells might maintain photosynthetic machinery, including PetC, in a state ready for rapid activation upon germination.

How do environmental factors and symbiotic associations influence the expression and activity of PetC in Nostoc punctiforme?

Nostoc punctiforme's versatility as both a free-living organism and a symbiont suggests that environmental factors and symbiotic associations likely influence the expression and activity of photosynthetic components, including PetC.

The search results indicate that symbiotic associations trigger significant cellular differentiation in Nostoc punctiforme, with chemical cues from plants stimulating the differentiation of infectious hormogonia . Conversely, Nostoc produces factors like nostopeptolide that repress hormogonium differentiation .

For PetC specifically, several environmental factors might modulate its expression and activity:

  • Light intensity and quality: As a component of the photosynthetic machinery, PetC expression likely responds to changes in light conditions.

  • Nutrient availability: Limitation of key nutrients might alter photosynthetic efficiency and thus the expression or activity of PetC.

  • Symbiotic state: The transition from free-living to symbiotic lifestyle could involve reorganization of the photosynthetic apparatus, potentially affecting PetC expression.

  • Carbon availability: In symbiosis, where the plant host might provide carbon compounds, the regulation of photosynthetic genes, including petC, might be altered.

What are the most effective approaches for expressing recombinant PetC from Nostoc punctiforme?

Based on successful strategies for other Nostoc punctiforme proteins, effective approaches for expressing recombinant PetC include:

  • Expression system selection: E. coli is commonly used for expressing cyanobacterial proteins, as demonstrated for the PetD subunit of the Cytochrome b6-f complex . For PetC specifically, special consideration should be given to the expression of the iron-sulfur cluster.

  • Codon optimization: Adapting the petC gene sequence to the codon usage preferences of the expression host can improve protein yield.

  • Fusion tags: Adding an affinity tag (e.g., His-tag) facilitates purification. For PetD, an N-terminal His-tag was successfully employed , and a similar approach might work for PetC.

  • Expression conditions: Optimizing growth temperature, induction timing, and media composition is crucial, especially for proteins containing cofactors like the [2Fe-2S] cluster in PetC.

  • Inclusion of iron-sulfur cluster assembly systems: Co-expression with iron-sulfur cluster assembly proteins or supplementation with iron and sulfur sources can enhance the formation of holo-PetC containing the [2Fe-2S] cluster.

What protocols are most effective for purifying and stabilizing recombinant PetC?

For purification and stabilization of recombinant PetC, the following protocols can be effective:

  • Affinity chromatography: If expressed with a His-tag, Ni-NTA affinity chromatography provides an efficient first purification step, as used for PetD .

  • Additional chromatography steps: Size exclusion chromatography or ion exchange chromatography can further enhance purity.

  • Buffer optimization: For PetD, a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 was used . For PetC, additional considerations for stabilizing the iron-sulfur cluster might include reducing agents and avoiding strong chelators.

  • Storage conditions: Storage as a lyophilized powder or in solution with glycerol (5-50%) at -20°C/-80°C is recommended, with aliquoting to avoid repeated freeze-thaw cycles .

  • Reconstitution protocol: For lyophilized protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is advised, with the addition of glycerol for long-term storage .

What analytical techniques are essential for characterizing the structural integrity and functional activity of recombinant PetC?

Several analytical techniques are essential for comprehensive characterization of recombinant PetC:

  • SDS-PAGE and Western blotting: To assess purity, molecular weight, and immunoreactivity of the recombinant protein.

  • UV-visible spectroscopy: To detect the characteristic absorption spectrum of the [2Fe-2S] cluster in properly folded PetC.

  • Circular dichroism (CD) spectroscopy: To evaluate secondary structure content and thermal stability.

  • Electron paramagnetic resonance (EPR) spectroscopy: To confirm the presence and integrity of the [2Fe-2S] cluster.

  • Mass spectrometry: To verify protein mass and detect post-translational modifications. For the related Rieske protein in M. laminosus, the measured mass (19,295 Da) differed slightly from the calculated mass (19,202 Da) , indicating potential modifications.

  • Functional assays: To assess electron transfer capability, typically using artificial electron donors and acceptors or reconstituted systems.

  • Protein-protein interaction assays: To verify interaction with other subunits of the Cytochrome b6-f complex.

How can researchers effectively generate and analyze petC mutants in Nostoc punctiforme?

For generating and analyzing petC mutants in Nostoc punctiforme, researchers can employ the following methodology:

  • In-frame deletion construction: Using PCR with primers designed to amplify DNA to the right and left of the targeted deletion with overlapping sequences, as demonstrated for other genes in Nostoc punctiforme .

  • Cloning into suicide vector: The deletion construct can be cloned into a suicide plasmid such as pRL278, which contains sacB for counter-selection .

  • Conjugative transfer: The suicide plasmid can be introduced into Nostoc punctiforme via triparental conjugation using E. coli strains as carriers .

  • Selection of recombinants: Single recombinants (plasmid integrated into the genome) can be selected using neomycin, followed by selection for double recombinants (plasmid eliminated) on sucrose-containing medium .

  • Confirmation of mutation: PCR can be used to confirm elimination of the wild-type gene and replacement with the inactivated version .

  • Phenotypic analysis: Comparative analysis of wild-type and mutant strains can include growth rates under different conditions, photosynthetic electron transport measurements, and spectroscopic characterization of the Cytochrome b6-f complex.

  • Complementation studies: Reintroduction of the wild-type petC gene to verify that observed phenotypes are specifically due to the petC mutation.

What considerations are important when designing experiments to study PetC interactions with other components of the photosynthetic electron transport chain?

When designing experiments to study PetC interactions with other components of the photosynthetic electron transport chain, several important considerations include:

  • Native vs. recombinant systems: Determining whether to study interactions in native membranes, purified complexes, or reconstituted systems with recombinant proteins.

  • Membrane environment: Considering the role of lipids and the membrane environment in facilitating proper interactions and function.

  • Temporal resolution: Electron transfer events occur on microsecond to millisecond timescales, requiring appropriate time-resolved techniques.

  • Redox potential control: Ensuring proper control of redox potentials to study electron transfer under physiologically relevant conditions.

  • Structural information integration: Utilizing available structural data to inform the design of interaction studies, particularly regarding predicted interface regions.

  • Genetic approaches: Considering complementary genetic approaches, such as suppressor mutations or synthetic lethality studies, to identify functional interactions.

  • In vivo vs. in vitro correlation: Designing experiments that bridge in vitro biochemical findings with in vivo physiological observations.

  • Cross-linking studies: Employing chemical cross-linking followed by mass spectrometry to identify interaction interfaces.

Composition and Properties of the Cytochrome b6-f Complex Subunits in Nostoc punctiforme

SubunitGeneCalculated Mass (Da)Measured Mass (Da)Function
Cytochrome fpetA32,27032,270Terminal electron carrier that transfers electrons to plastocyanin or cytochrome c6
Cytochrome b6petB24,88424,710Contains heme groups for electron transfer; forms the Qo and Qi sites
Rieske ISPpetC19,20219,295Contains [2Fe-2S] cluster; mediates electron transfer from quinol to cytochrome f
Subunit IVpetD17,52217,528Forms part of the Qo and Qi sites; amino acid sequence for N. punctiforme: MATQKKPDLSDPQLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFAAIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMGSVPVGLILVPFIENVNKFQNPFRRPVATTVFLVGTLVTVWLGIGAALPLDKSLTLGLF
PetGpetGNot applicable4,057Small subunit; likely provides structural support
PetMpetM3,8423,841Small subunit; likely provides structural support
PetLpetL3,5303,530Small subunit; likely provides structural support
PetNpetN3,3043,304Small subunit; likely provides structural support

Table compiled from data in search result

  • Structural Conservation: The Cytochrome b6-f complex structures from cyanobacteria separated by approximately 109 years of evolution are very similar, with a high level of sequence identity (>60%) for the four large protein subunits, including PetC .

  • Dimer Organization: The complex is organized as a dimer containing 26 transmembrane helices, with each monomer unit consisting of eight polypeptide subunits .

  • Small Subunit Functions: The four small subunits (PetG, PetL, PetM, and PetN) may provide structural support, arranged as a "picket fence" at the lateral boundary of the dimer, or perhaps function as "chaperone" peptides that guide the assembly of the complex .

  • Molecular Weights: The measured molecular weights of the subunits generally match well with the calculated values, with slight differences potentially indicating post-translational modifications .

  • Expression Systems: E. coli expression systems have been successfully used for producing recombinant forms of Cytochrome b6-f complex subunits from Nostoc punctiforme, as demonstrated for PetD .

  • Storage Conditions: Recombinant proteins from Nostoc punctiforme can be stored as lyophilized powders or in solution with glycerol at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles .

  • Cellular Differentiation: Nostoc punctiforme's ability to differentiate into specialized cell types (vegetative cells, heterocysts, hormogonia, and akinetes) likely affects the expression and function of photosynthetic components, including the Cytochrome b6-f complex, in these different cell types .

What are the critical unresolved questions about PetC structure and function in Nostoc punctiforme?

Several critical questions remain unresolved regarding PetC in Nostoc punctiforme:

  • Cell type-specific expression: How does PetC expression and function vary across different cell types (vegetative cells, heterocysts, hormogonia, and akinetes)?

  • Symbiotic regulation: How is PetC expression and function regulated during the transition from free-living to symbiotic lifestyle?

  • Post-translational modifications: What post-translational modifications occur in PetC, and how do they affect its function?

  • Interaction network: What is the complete interaction network of PetC with other proteins beyond the Cytochrome b6-f complex?

  • Evolutionary adaptations: What specific adaptations in Nostoc punctiforme PetC contribute to its unique ecological niche?

Addressing these questions will require integrated approaches combining molecular genetics, biochemistry, structural biology, and systems biology techniques.

What emerging technologies might advance our understanding of PetC biology?

Emerging technologies that could significantly advance our understanding of PetC biology include:

  • Cryo-electron tomography: For visualizing the Cytochrome b6-f complex in its native membrane environment at near-atomic resolution.

  • Single-molecule techniques: For studying the dynamics of electron transfer and protein-protein interactions at the individual molecule level.

  • Advanced mass spectrometry: For comprehensive characterization of post-translational modifications and protein-protein interactions.

  • CRISPR-based approaches: For precise genome editing in Nostoc punctiforme to study PetC function.

  • Integrative multi-omics: Combining transcriptomics, proteomics, and metabolomics to understand the systems-level impact of PetC function.

  • Advanced spectroscopic techniques: For probing electron transfer events with improved temporal and spatial resolution.

These technologies promise to provide unprecedented insights into the structure, function, and regulation of PetC in Nostoc punctiforme, potentially revealing new principles of photosynthetic electron transport that could inform biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.