Recombinant Nostoc punctiforme Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
petD; Npun_F0311; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Target Names
petD
Target Protein Sequence
MATQKKPDLSDPQLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFAAIVALAVLDPA MTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMGSVPVGLILVPFIENVNKF QNPFRRPVATTVFLVGTLVTVWLGIGAALPLDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of PetD in the cytochrome b6-f complex?

PetD forms a crucial subcomplex with cytochrome b6 that serves as a template for the assembly of other components of the cytochrome b6-f complex. This mildly protease-resistant subcomplex facilitates the assembly of cytochrome f (Cyt f) and PetG, ultimately producing a protease-resistant cytochrome moiety. Research has demonstrated that PetD becomes significantly less stable in the absence of cytochrome b6, and importantly, the synthesis of cytochrome f is greatly reduced when either cytochrome b6 or PetD is inactivated .

This indicates that both cytochrome b6 and PetD are prerequisites for the synthesis of cytochrome f, establishing a clear assembly dependency hierarchy within the complex. The assembly process continues with PetC and PetL proteins participating in the formation of the functional dimer. The reduced synthesis of cytochrome f when PetD is absent underscores PetD's fundamental role in maintaining the structural integrity of the entire complex.

How can researchers identify petD gene expression patterns in Nostoc punctiforme?

To identify petD gene expression patterns, researchers commonly employ a combination of techniques:

  • RNA isolation and RT-qPCR analysis: This allows quantification of petD transcript levels under different conditions. The challenge with Nostoc punctiforme is proper cell lysis due to its thick extracellular matrix.

  • Protein extraction and immunoblotting: Using antibodies against PetD enables detection of protein expression levels. As demonstrated in studies of the cytochrome b6-f complex, immunoblotting with anti-PetD antibodies can be performed following blue native polyacrylamide gel electrophoresis (BN-PAGE) to assess the presence of PetD in both monomeric and dimeric forms of the complex .

  • Pulse-chase labeling: This technique allows tracking of newly synthesized PetD. Studies have shown that pulse labeling with radioactive amino acids for different time intervals (10 minutes versus 30 minutes) can reveal differences in the synthesis rates of cytochrome b6-f complex components including PetD .

What protein-protein interactions does PetD establish within the cytochrome b6-f complex?

PetD forms critical interactions with multiple components of the cytochrome b6-f complex:

  • Primary interaction with cytochrome b6: PetD forms a foundational subcomplex with cytochrome b6 that exhibits mild resistance to proteolytic degradation. This interaction appears to be the initial step in complex assembly .

  • Secondary interactions with Cyt f and PetG: Following the formation of the PetD-cytochrome b6 subcomplex, these proteins interact with Cyt f and PetG to form a more complete cytochrome moiety with enhanced protease resistance .

  • Tertiary interactions with PetC and PetL: These proteins join the assembly last, contributing to the formation of the functional dimeric complex .

The hierarchical nature of these interactions is evidenced by observations that synthesis of Cyt f is significantly reduced when either cytochrome b6 or PetD is inactivated, demonstrating their prerequisite role in the assembly process.

What experimental approaches are most effective for studying the role of PetD in the assembly of the cytochrome b6-f complex?

Several sophisticated experimental approaches have proven effective for investigating PetD's role in complex assembly:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) combined with immunoblotting: This approach allows visualization of different assembly states of the cytochrome b6-f complex (monomer, dimer, and intermediate forms). Research has shown that in mutants with disrupted assembly factors, the ratio between monomer and dimer forms is altered, and intermediate assembly states may accumulate .

  • Pulse-chase radioactive labeling with immunoprecipitation: This technique enables tracking of newly synthesized proteins and their incorporation into complexes. Studies have demonstrated that the rate of labeling of PetD can be affected in assembly mutants, providing insights into the dynamics of complex formation .

  • Polysome profiling: Analysis of ribosomal loading on specific mRNAs can reveal alterations in translation initiation efficiency, which may affect PetD synthesis .

  • Protein stability assays: Treatment with protein synthesis inhibitors (e.g., lincomycin) followed by time-course sampling and immunoblotting can determine the degradation rates of assembled versus unassembled PetD .

These combined approaches provide a comprehensive view of PetD's role from translation through assembly and stability within the complex.

How do mutations in petD affect cytochrome b6-f complex assembly and photosynthetic electron transport?

Mutations in petD can have multiple effects on complex assembly and function:

  • Altered complex stability: Studies of assembly-defective mutants have revealed changes in the ratio between monomeric and dimeric forms of the cytochrome b6-f complex. In some cases, an increase in intermediate assembly forms is observed, indicating stalled assembly processes .

  • Reduced synthesis of interacting partners: When PetD function is compromised, synthesis of cytochrome f is typically reduced, demonstrating the interdependence of complex components .

  • Accelerated degradation of newly synthesized proteins: Pulse-chase experiments have shown that in assembly-defective lines, newly synthesized components of the cytochrome b6-f complex exhibit significantly shorter half-lives compared to wild-type plants, while fully assembled complexes remain relatively stable .

  • Impact on photosynthetic electron transport: The compromised assembly of the cytochrome b6-f complex due to petD mutations inevitably affects electron transport efficiency, potentially leading to physiological consequences such as reduced growth and altered response to high light conditions.

What methodological challenges exist in producing recombinant PetD from Nostoc punctiforme and how can they be addressed?

Production of recombinant PetD from Nostoc punctiforme presents several challenges:

  • Membrane protein expression issues: As a membrane protein component, PetD is often difficult to express in soluble, correctly folded form. Solution approaches include:

    • Using specialized expression systems designed for membrane proteins

    • Creating fusion constructs with solubility-enhancing tags

    • Expressing truncated versions that retain key functional domains

  • Co-expression requirements: Since PetD stability depends on interaction with cytochrome b6, co-expression of both proteins may be necessary for obtaining stable recombinant PetD. Dual expression vectors or sequential induction systems can facilitate this approach.

  • Post-translational modification concerns: If PetD undergoes specific modifications in Nostoc punctiforme, these may be absent in heterologous expression systems. In such cases, expression in closely related cyanobacterial hosts may be preferable.

  • Purification complications: The hydrophobic nature of PetD requires specialized purification approaches. Strategies include:

    • Using mild detergents that maintain protein structure

    • Employing affinity purification with carefully positioned tags that don't interfere with protein folding

    • Implementing gradient purification techniques optimized for membrane proteins

How can researchers distinguish between direct and indirect effects of petD mutations on cytochrome b6-f complex assembly?

Distinguishing direct from indirect effects requires a multi-faceted experimental approach:

  • Targeted mutagenesis: Creating specific mutations in conserved versus non-conserved regions of petD can help determine which protein domains are directly involved in complex assembly. The genome sequence available for Nostoc punctiforme ATCC 29133 (PCC 73102) facilitates such precision approaches .

  • Complementation studies: Introducing wild-type petD into mutant backgrounds can confirm whether observed phenotypes are directly caused by the petD mutation. Varying levels of complementation may indicate primary versus secondary effects.

  • Protein-protein interaction analyses: Techniques such as yeast two-hybrid, pull-down assays, or cross-linking experiments can determine whether mutations affect direct protein interactions involving PetD.

  • Time-course assembly studies: By tracking complex assembly over time using pulse-chase labeling and BN-PAGE, researchers can determine which assembly steps are immediately affected by petD mutations (direct effects) versus those affected later in the process (indirect effects) .

  • Comparative analysis with other mutants: Comparing assembly defects in petD mutants with those in mutants of other complex components can reveal similarities and differences that help distinguish primary from secondary effects.

What strategies can be employed to enhance expression and stability of recombinant PetD protein?

Several strategies can improve recombinant PetD expression and stability:

StrategyImplementationExpected Outcome
Codon optimizationAdjust codon usage to match expression hostIncreased translation efficiency
Fusion tagsN- or C-terminal fusion with solubility enhancers (MBP, SUMO, etc.)Improved solubility and expression
Co-expression systemsSimultaneous expression of PetD with cytochrome b6Enhanced stability through formation of natural subcomplex
Chaperone co-expressionInclude molecular chaperones in expression systemImproved folding and reduced aggregation
Expression temperature optimizationLower growth temperature during inductionSlower expression allowing proper folding
Membrane-mimetic environmentsAddition of detergents or lipids during purificationPreservation of native structure
Directed evolution approachesRandom mutagenesis followed by selection for stable variantsIdentification of stabilizing mutations

How does the assembly process of the cytochrome b6-f complex in Nostoc punctiforme compare to other cyanobacteria?

Compared to other cyanobacteria, Nostoc punctiforme's cytochrome b6-f complex assembly process shows both similarities and distinctive features:

  • Conserved core assembly pathway: The fundamental assembly pathway appears conserved, with the PetD-cytochrome b6 subcomplex forming first, followed by addition of other components. This pattern is similar to that observed in other photosynthetic organisms .

  • Unique genomic context: Nostoc punctiforme ATCC 29133 has a fully sequenced genome available, revealing the genomic organization of petD and related genes, which may differ from other cyanobacteria .

  • Environmental adaptations: As a cyanobacterium capable of forming symbiotic relationships with plants, Nostoc punctiforme may have evolved specific regulatory mechanisms for cytochrome b6-f complex assembly that respond to symbiotic versus free-living conditions .

  • Heterocyst-specific considerations: Unlike unicellular cyanobacteria such as Synechocystis, Nostoc punctiforme forms specialized cells called heterocysts for nitrogen fixation. These cells have modified photosynthetic apparatus, potentially affecting cytochrome b6-f complex assembly and regulation .

The assembly process in Nostoc punctiforme integrates both phylogenetically conserved mechanisms and adaptations specific to its ecological niche and developmental complexity.

What analytical techniques are most informative for characterizing recombinant PetD structure and function?

A comprehensive characterization of recombinant PetD structure and function requires multiple analytical approaches:

  • Structural analysis techniques:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Nuclear magnetic resonance (NMR) for detailed structural information of soluble domains

    • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination, ideally of PetD in complex with cytochrome b6

  • Functional characterization:

    • Reconstitution assays in liposomes to assess electron transport capability

    • Binding studies to quantify interactions with other complex components

    • EPR spectroscopy to examine electron transfer properties

  • Stability and quality assessment:

    • Size-exclusion chromatography to evaluate oligomeric state

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to identify stable domains and flexible regions

  • Integration analysis:

    • Blue native PAGE to assess incorporation into the cytochrome b6-f complex

    • Electron microscopy to visualize complex formation

These techniques provide complementary information about recombinant PetD's structural integrity and functional capacity.

How can researchers effectively study the impact of environmental factors on petD expression and function?

To study environmental impacts on petD expression and function:

  • Controlled growth studies: Cultivate Nostoc punctiforme under varying conditions (light intensity, nutrient availability, temperature, CO2 levels) followed by analysis of:

    • petD transcript levels via RT-qPCR

    • PetD protein abundance via immunoblotting

    • Cytochrome b6-f complex assembly status via BN-PAGE

  • Reporter gene systems: Construct petD promoter-reporter fusions to monitor environmental influences on gene expression in real-time.

  • Comparative analyses between free-living and symbiotic states: Nostoc punctiforme forms symbiotic relationships with plants, offering an opportunity to compare petD expression between these distinct lifestyles .

  • In situ localization studies: Immunogold labeling combined with electron microscopy can reveal changes in PetD localization under different environmental conditions.

  • Cross-linking and co-immunoprecipitation: These techniques can identify environment-dependent changes in PetD's interaction partners.

A multi-parametric experimental design that simultaneously varies multiple environmental factors can reveal complex regulatory patterns that might be missed in single-variable experiments.

How can contradictory results in PetD function studies be reconciled and interpreted?

Contradictory results in PetD research can be addressed through systematic analysis:

  • Methodological differences: Carefully compare experimental methods, particularly:

    • Protein extraction protocols (detergents, buffer composition)

    • Assay conditions (temperature, pH, ionic strength)

    • Detection methods (antibody specificity, labeling approach)

  • Genetic background variations: Differences in strain backgrounds can significantly impact results. Ensure comparisons are made between appropriate strains and consider:

    • Creating isogenic lines that differ only in the petD gene

    • Complementation studies to confirm phenotype-genotype relationships

  • Environmental and growth condition inconsistencies: Standardize:

    • Growth phase at harvest

    • Light conditions during cultivation

    • Media composition

  • Experimental validation through multiple approaches: When contradictory results emerge, employ orthogonal methods to address the same question. For example, if BN-PAGE and immunoblotting give contradictory results regarding complex assembly, add techniques like sucrose gradient fractionation or co-immunoprecipitation .

  • Quantitative rather than qualitative analysis: Where possible, use quantitative measurements with appropriate statistical analysis rather than qualitative assessments to facilitate more rigorous comparisons between studies.

What are the most common technical pitfalls in recombinant PetD studies and how can they be avoided?

Common technical challenges in recombinant PetD studies include:

Technical ChallengePotential Solution
Poor protein solubilityUse specialized membrane protein expression systems; optimize detergent selection; create fusion constructs
Improper foldingCo-express with natural binding partners; optimize expression temperature and induction conditions; include molecular chaperones
Low expression levelsCodon optimization; use strong promoters appropriate for the expression host; optimize growth media
Degradation during purificationInclude protease inhibitors; minimize purification time; maintain cold temperatures; consider on-column purification strategies
Loss of structural integrityStabilize with appropriate lipids or detergents; maintain physiological pH and ionic strength
Non-specific antibody bindingGenerate peptide-specific antibodies; perform extensive validation of commercial antibodies; include appropriate controls
Aggregation during storageIdentify optimal buffer conditions through stability screens; consider addition of glycerol or other stabilizing agents; store in small aliquots

Implementing these solutions preemptively can significantly improve the success rate of recombinant PetD studies and enhance data reliability.

How can CRISPR-Cas technology be applied to study petD function in Nostoc punctiforme?

CRISPR-Cas technology offers powerful approaches for investigating petD function:

  • Precise gene editing: Create specific mutations in conserved domains of petD to determine structure-function relationships. Since the Nostoc punctiforme genome sequence is available, guide RNA design can be highly specific .

  • Promoter modification: Engineer inducible or repressible promoters to control petD expression levels, allowing temporal studies of complex assembly.

  • Reporter gene insertion: Insert fluorescent protein tags at the genomic locus to monitor PetD expression and localization without disrupting natural regulation.

  • Epitope tagging: Add small epitope tags to the genomic petD to facilitate immunoprecipitation and protein interaction studies while maintaining the gene in its native genomic context.

  • CRISPRi approaches: Use catalytically inactive Cas9 (dCas9) to modulate petD expression without modifying the gene sequence, allowing dose-dependent studies of PetD's role in complex assembly.

  • High-throughput mutant screening: Generate libraries of petD variants to identify critical residues for protein function, complex assembly, and stability.

CRISPR-Cas approaches must be optimized for the specific characteristics of Nostoc punctiforme, including its filamentous growth habit and potential polyploidy, which may complicate the generation of homogeneous mutants.

What emerging technologies hold promise for advancing our understanding of PetD's role in the cytochrome b6-f complex?

Several cutting-edge technologies are poised to transform our understanding of PetD:

  • Cryo-electron tomography: Enables visualization of the cytochrome b6-f complex in its native membrane environment, revealing how PetD contributes to both structure and organization.

  • Single-molecule fluorescence techniques: Allow tracking of individual complex assembly events in real-time, illuminating the dynamic process of PetD incorporation.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides detailed information about protein dynamics and conformational changes, revealing how PetD responds to different physiological conditions.

  • Native mass spectrometry: Enables analysis of intact membrane protein complexes, preserving non-covalent interactions and subunit stoichiometry.

  • AlphaFold and other AI-based structure prediction tools: Offer insights into PetD structure and interactions, particularly valuable for regions that remain challenging for traditional structural biology techniques.

  • Spatial transcriptomics and proteomics: Reveal how petD expression and PetD localization vary across different cell types within Nostoc punctiforme filaments, particularly between vegetative cells and heterocysts.

  • Long-read sequencing technologies: Provide improved genomic context for the petD gene, including potential regulatory elements that influence its expression.

These emerging approaches, especially when used in combination, promise to significantly advance our understanding of PetD's multifaceted roles in photosynthetic electron transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.