Recombinant Nostoc punctiforme Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

PetB is a core subunit of the cytochrome b6f complex (Cyt b6f), which mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) and enables cyclic electron flow . Key functions include:

  • Electron Transport: Facilitates plastoquinol oxidation and proton gradient generation via heme groups (b566 and b562) .

  • State Transitions: Cyt b6f stability is essential for balancing energy distribution between PSI and PSII, as shown by destabilization in PetN-deficient mutants .

  • Protein Interactions: PetB exhibits strong coevolution with PetD (subunit IV) (r = 0.89) and moderate correlation with PetA (r = 0.67), indicating functional interdependence .

Evolutionary Conservation

PetB in cyanobacteria shares high sequence identity with plastid-encoded homologs (mean substitution rate K = 0.1891 vs. 0.2073 in plastids) . This conservation underscores its indispensable role in oxygenic photosynthesis.

Complex Stability and Mutant Phenotypes

  • PetN Dependency: Deletion of the small subunit PetN reduces Cyt b6f levels by 75–80%, impairing oxygen evolution and state transitions .

  • Inhibitor Resistance: PetB mutants show partial insensitivity to DBMIB, a Cyt b6f inhibitor, due to altered plastoquinone pool dynamics .

Interaction Networks

Correlation analysis (r > 0.8) identifies PetB’s interaction partners:

SubunitInteraction PartnerCorrelation Coefficient (r)
PetBPetD (subunit IV)0.89
PetBPetA (cytochrome f)0.67
PetBNdhA (NADH dehydrogenase)0.82

These interactions suggest cross-complex coordination between photosynthetic and respiratory electron transport chains .

Recombinant Production

  • Cloning: The petB gene (locus: Npun_F0310) is codon-optimized for E. coli expression .

  • Purification: Affinity chromatography via His tag, followed by gel filtration for monomer isolation .

Research Applications

  • Mechanistic Studies: Used to dissect electron transport kinetics and inhibitor binding .

  • Drug Discovery: Target for herbicides affecting photosynthetic efficiency .

  • Biotechnology: Template for engineering artificial photosynthetic systems .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly specify it in your order notes, and we will prepare your order accordingly.
Lead Time
The delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributor for specific delivery time details.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Avoid repeated freezing and thawing. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Recombinant Nostoc punctiforme Cytochrome b6 (petB) should be reconstituted in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point for your preparation.
Shelf Life
The shelf life of Recombinant Nostoc punctiforme Cytochrome b6 (petB) is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store Recombinant Nostoc punctiforme Cytochrome b6 (petB) at -20°C/-80°C. To ensure optimal stability, aliquot the protein for multiple uses and minimize repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We prioritize the development of specified tag types if you have a particular requirement. Please inform us of your tag type preference, and we will strive to fulfill your request.
Synonyms
petB; Npun_F0310; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Target Names
petB
Target Protein Sequence
MANVYDWFEERLEIQALAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYRP TVTEAFSSVEYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVS GVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATL TRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Recombinant Nostoc punctiforme Cytochrome b6 (petB) is a crucial component of the cytochrome b6-f complex. This complex plays a pivotal role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI). It also participates in cyclic electron flow around PSI and state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.