Recombinant Nostoc punctiforme NAD (P)H-quinone oxidoreductase subunit 3

What is the functional role of NAD(P)H-quinone oxidoreductase subunit 3 in Nostoc punctiforme?

NAD(P)H-quinone oxidoreductase subunit 3 (NdhC) is a component of the NDH-1 complex in Nostoc punctiforme. This protein is encoded by the ndhC gene (also known as Npun_R5548) and functions as an integral membrane subunit of the NAD(P)H dehydrogenase . In cyanobacteria, NDH-1 complexes exist in multiple forms (NDH-1L, NDH-1M, and NDH-1S) and participate in diverse physiological processes including respiration, cyclic electron flow around photosystem I, and inorganic carbon uptake . The NdhC subunit is particularly important for the assembly and stability of the membrane domain of these complexes. Functional studies in cyanobacteria have demonstrated that NDH-1 complexes containing NdhC are essential for cellular respiration and contribute to carbon acquisition mechanisms under low CO2 conditions .

What are the biochemical properties of recombinant NdhC protein?

Recombinant Nostoc punctiforme NdhC is a 120-amino acid protein with a highly hydrophobic character, containing multiple transmembrane domains . The full amino acid sequence is: MFVLSGYEYLLGFFIICSLVPALALSASKLLRPSGYAPERRTTYESGMEPIGGAWIQFNIRYYMFALVFVVFDVETVFLYPWAVAFHRLGLLAFIEALVFIAILVVALVYAWRKGALEWS . This hydrophobic nature reflects its role as an integral membrane protein and presents specific challenges for recombinant expression and purification. When expressed in E. coli with an N-terminal His-tag, the protein maintains its structural integrity and can be purified to >90% homogeneity as determined by SDS-PAGE analysis . The protein demonstrates stability in Tris/PBS-based buffer (pH 8.0) supplemented with 6% trehalose, which helps prevent aggregation during storage .

How should recombinant NdhC be stored and reconstituted for experimental use?

For optimal stability, recombinant NdhC should be stored as a lyophilized powder at -20°C to -80°C . Upon receipt, it is recommended to briefly centrifuge the vial to ensure all material is at the bottom. For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL . To prevent protein degradation during storage of the reconstituted solution, adding glycerol to a final concentration of 5-50% is recommended, with 50% being the typical standard . The reconstituted protein should then be aliquoted to minimize freeze-thaw cycles and stored at -20°C to -80°C for long-term use. For short-term applications (up to one week), working aliquots can be maintained at 4°C . This storage protocol helps maintain protein stability and functionality for downstream applications.

How does NdhC contribute to the structure and function of different NDH-1 complexes?

NdhC serves as an essential structural component in the membrane domain of NDH-1 complexes. In cyanobacteria, these complexes exist in several distinct forms that perform specialized functions. Studies in Synechocystis sp. PCC 6803, which has homologous NDH-1 complexes to those in Nostoc punctiforme, have revealed that NdhC is present in both NDH-1L (large) and NDH-1M (medium) complexes . The NDH-1L complex, which requires NdhC for proper assembly, is primarily involved in respiratory electron transport and is essential for photoheterotrophic growth . Deletion of genes encoding other NDH-1 subunits, such as NdhB (as in the M55 mutant), results in the absence of both NDH-1L and NDH-1M complexes, leading to severe functional deficiencies including impaired P700+ rereduction and inability to take up CO2 . This indicates that NdhC plays a crucial structural role that is required for the assembly and stability of these functional complexes.

What approaches can be used to study protein-protein interactions involving NdhC within NDH-1 complexes?

Investigating protein-protein interactions involving NdhC requires specialized approaches due to its membrane-embedded nature. Several methodologies have proven effective:

• Blue-native PAGE coupled with western blotting: This technique allows separation of intact membrane protein complexes and identification of NdhC-containing subcomplexes. Subsequent second-dimension SDS-PAGE can resolve individual subunits that interact with NdhC .

• Co-immunoprecipitation with crosslinking: Since membrane protein interactions may be transient or disrupted during solubilization, chemical crosslinking prior to immunoprecipitation can capture native interactions. Using antibodies against the His-tag of recombinant NdhC can pull down interaction partners.

• Split-reporter protein complementation assays: Fusing fragments of reporter proteins (e.g., split-GFP or split-luciferase) to NdhC and potential interaction partners can visualize interactions in vivo when the fragments reconstitute an active reporter upon interaction.

• Surface plasmon resonance (SPR): This technique can measure binding kinetics between purified recombinant NdhC (immobilized in nanodiscs or detergent micelles) and soluble domains of other NDH-1 subunits.

These approaches have revealed that NdhC interacts closely with NdhA, NdhB, and NdhD subunits to form the membrane domain of NDH-1 complexes, providing structural support for the peripheral arm containing catalytic subunits.

How does the function of NdhC differ under various environmental conditions?

Research has shown that while NdhC itself does not undergo major structural modifications in response to environmental changes, the composition of the NDH-1 complexes it participates in can shift dramatically. For example, in Synechocystis, low CO2 conditions induce the expression of the NDH-1S complex containing NdhD3, NdhF3, CupA, and Sll1735, which works in conjunction with NDH-1M (containing NdhC) to facilitate CO2 uptake . The table below summarizes known functional roles of NdhC-containing complexes under different environmental conditions:

What expression systems yield optimal production of functional recombinant NdhC?

Producing functional recombinant NdhC presents significant challenges due to its hydrophobic nature and membrane localization. Several expression systems have been evaluated, with E. coli being the most commonly used host . The optimal expression system should balance protein yield with proper folding and minimal toxicity to the host.

For E. coli-based expression, the following protocol has proven effective:

• Vector selection: pET series vectors with an N-terminal His-tag provide good expression control and facilitate purification .

• E. coli strain: BL21(DE3) or C41(DE3)/C43(DE3) strains are recommended, with the latter two being specifically engineered for membrane protein expression.

• Growth conditions: Culture at lower temperatures (16-20°C) after induction reduces inclusion body formation. Induction with a lower IPTG concentration (0.1-0.5 mM) over a longer period (overnight) improves folding.

• Membrane extraction: Gentle extraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin preserves protein structure better than harsher detergents like Triton X-100.

• Purification strategy: Immobilized metal affinity chromatography (IMAC) using the His-tag, followed by size exclusion chromatography, yields protein with >90% purity .

Alternative expression systems include cell-free systems supplemented with lipids or nanodiscs, which can directly incorporate NdhC into a membrane-like environment during synthesis, potentially improving folding and stability.

How can researchers verify the functionality of recombinant NdhC protein?

Verifying the functionality of recombinant NdhC is essential before using it in downstream applications. Multiple complementary approaches should be employed:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure content

  • Limited proteolysis to verify proper folding through digestion pattern analysis

  • Thermal shift assays to determine protein stability

• Membrane incorporation verification:

  • Reconstitution into liposomes followed by flotation assays

  • Fluorescence-based membrane insertion assays using environment-sensitive probes

• Functional assays:

  • NADH/NADPH oxidation activity when reconstituted with other NDH-1 subunits

  • Electron transfer to quinone analogs (DCPIP or decylubiquinone)

  • Proton pumping assays in proteoliposomes using pH-sensitive dyes

• Protein-protein interaction analysis:

  • Pull-down assays with known interaction partners from NDH-1 complexes

  • Isothermal titration calorimetry to measure binding affinities

A genuinely functional recombinant NdhC should demonstrate proper membrane incorporation, maintain its predicted alpha-helical structure, and retain the ability to interact with partner proteins from the NDH-1 complex.

What approaches can be used to study the role of NdhC in electron transport?

Investigating the specific contribution of NdhC to electron transport requires specialized techniques that can monitor electron flow within membrane complexes:

• Electron paramagnetic resonance (EPR) spectroscopy: This technique can detect changes in the redox state of electron carriers within the NDH-1 complex. Using site-directed spin labeling of NdhC can provide insights into conformational changes during electron transport.

• Electrochemical analysis: Protein film voltammetry of reconstituted NDH-1 complexes containing NdhC can measure direct electron transfer rates and the impact of mutations or inhibitors.

• Fluorescence-based assays: NADH/NADPH oxidation can be monitored through changes in autofluorescence, while quinone reduction can be tracked using fluorescent quinone analogs. These assays can determine the impact of NdhC on electron transfer rates through NDH-1.

• P700+ reduction kinetics: In intact cells or thylakoid membranes, the re-reduction rate of photooxidized P700 (the reaction center chlorophyll of PSI) provides insights into cyclic electron flow involving NDH-1. Comparing wild-type with NdhC-deficient mutants reveals its contribution to this process .

• Membrane potential measurements: Using voltage-sensitive dyes in reconstituted proteoliposomes containing NDH-1 complexes can assess the coupling between electron transport and proton translocation, a process that NdhC may influence through its membrane domain structure.

These approaches, particularly when combined with targeted mutations of NdhC, can illuminate its specific role in electron transport pathways.

How can researchers interpret discrepancies between in vitro and in vivo studies of NdhC function?

Discrepancies between in vitro and in vivo studies of NdhC function are common and can arise from several factors. When encountering such inconsistencies, researchers should consider:

• Protein-lipid interactions: The native membrane environment in vivo contains specific lipids that may be absent in vitro. Phosphatidylglycerol and sulfoquinovosyldiacylglycerol, abundant in cyanobacterial membranes, can significantly impact NDH-1 complex stability and activity. Reconstitution experiments should attempt to mimic the native lipid composition.

• Missing protein partners: In vivo, NdhC functions as part of multiprotein complexes (NDH-1L or NDH-1M) . In vitro studies may lack important stabilizing or activating partners. Comparing purified NdhC alone versus NdhC in partially assembled complexes can help identify such effects.

• Post-translational modifications: In vivo, NdhC may undergo modifications not replicated in heterologous expression systems. Mass spectrometry analysis of native versus recombinant NdhC can identify such differences.

• Redox environment: The cellular redox state significantly impacts electron transport. In vitro systems often use artificial electron donors/acceptors that may not perfectly mimic physiological conditions. Adjusting redox potentials in vitro to match cellular conditions can reduce discrepancies.

• Compensatory mechanisms: In vivo, cells may compensate for experimental perturbations through regulatory responses impossible to replicate in vitro. Comparing acute responses (before compensation occurs) with long-term adaptations can help separate direct effects from compensatory responses.

When analyzing such discrepancies, researchers should develop models that integrate both in vitro mechanistic insights and in vivo physiological observations, recognizing that each approach provides complementary rather than contradictory information.

What approaches can distinguish between direct and indirect effects of NdhC manipulation in cyanobacteria?

Distinguishing direct from indirect effects of NdhC manipulation requires careful experimental design and analysis:

• Temporal analysis: Direct effects typically occur rapidly after perturbation, while indirect effects emerge later as cellular responses develop. Time-course experiments following NdhC deletion or inhibition can separate these temporal phases.

• Complementation studies: Reintroducing functional NdhC should rapidly reverse direct effects while taking longer to normalize indirect effects. Using an inducible expression system allows precise temporal control for such experiments.

• Domain-specific mutations: Creating targeted mutations in different functional domains of NdhC can help map specific functions to protein regions. For example, mutations affecting interaction with other NDH-1 subunits versus those affecting membrane anchoring may produce different phenotype subsets.

• Metabolomics and flux analysis: Isotope labeling combined with metabolic flux analysis can trace the propagation of effects through metabolic networks, helping identify primary (direct) versus secondary metabolic changes.

• Synthetic rescue approaches: Bypassing the need for NdhC through alternative electron transport pathways can reveal which phenotypes are directly related to electron transport versus other potential roles of NdhC.

Case studies in Synechocystis have demonstrated this approach by revealing that the slow P700+ rereduction kinetics in NDH-1 mutants could be directly attributed to impaired cyclic electron flow, while growth defects under fluctuating light represented indirect effects stemming from altered redox balance and energy distribution .

How should researchers compare the evolutionary conservation of NdhC across cyanobacterial species?

Analyzing the evolutionary conservation of NdhC across cyanobacterial species provides insights into its fundamental versus species-specific functions. A comprehensive comparative approach should include:

• Multiple sequence alignment: Using MUSCLE or CLUSTAL algorithms to align NdhC sequences from diverse cyanobacteria, including free-living species (like Nostoc punctiforme), symbiotic species, and those from extreme environments. Visualization with tools like WebLogo can identify highly conserved residues.

• Structural conservation analysis: Mapping conservation scores onto predicted structural models using programs like ConSurf. This approach has revealed that transmembrane regions of NdhC show higher conservation than loop regions, reflecting functional constraints on membrane integration.

• Phylogenetic tree construction: Building trees using Maximum Likelihood or Bayesian methods with appropriate outgroups (such as chloroplast NdhC). Prior studies have used NdhH as an outgroup sequence for related analyses .

• Selection pressure analysis: Calculating dN/dS ratios to identify sites under positive or purifying selection. NdhC typically shows strong purifying selection in transmembrane regions, indicating functional constraint.

• Comparative genomics: Analyzing the genomic context of ndhC across species to identify conserved operon structures and potential co-evolution with interacting partners.

This approach has revealed that while NdhC maintains high sequence conservation in its core functional domains across diverse cyanobacteria, there are species-specific adaptations in regulatory regions that likely reflect environmental adaptations to different light and carbon availability conditions.

How are innovative imaging techniques advancing our understanding of NdhC localization and dynamics?

Recent advances in super-resolution microscopy and correlative light and electron microscopy (CLEM) have transformed our ability to visualize NdhC within the complex membrane architecture of cyanobacteria. These techniques have revealed that NDH-1 complexes containing NdhC are not uniformly distributed throughout thylakoid membranes but organize into distinct functional domains.

Fluorescence recovery after photobleaching (FRAP) and single-particle tracking of tagged NdhC proteins have demonstrated that these complexes exhibit restricted mobility within thylakoid membranes, suggesting interactions with other membrane components or cytoskeletal elements. Time-lapse imaging under changing environmental conditions has shown dynamic reorganization of NDH-1 complexes in response to shifts in light intensity or carbon availability, correlating with functional adaptations in electron transport and carbon acquisition pathways .

Cryo-electron tomography combined with subtomogram averaging is now being applied to visualize native NDH-1 complexes within their membrane environment, revealing previously undetected structural features and interactions that may be lost during traditional purification procedures. These approaches are providing unprecedented insights into how NdhC contributes to the supramolecular organization of bioenergetic complexes in cyanobacterial membranes.

What role might NdhC play in the adaptation of Nostoc punctiforme to extreme environments?

Nostoc punctiforme is known for its remarkable ability to survive in extreme environments, including desiccation, freezing, and high UV radiation. Research is beginning to uncover how NDH-1 complexes containing NdhC contribute to this environmental resilience.

Under desiccation conditions, reconfiguration of electron transport chains helps maintain redox balance during metabolic downregulation. NDH-1 complexes appear to be modified to prevent excessive reactive oxygen species formation when normal electron flow is disrupted. In nitrogen-fixing heterocysts, which provide an anaerobic environment for nitrogenase activity, the composition and activity of NDH-1 complexes differ from those in vegetative cells . These specialized cells must inactivate oxygen-evolving photosystem II while maintaining cyclic electron flow around photosystem I to generate ATP without producing oxygen.

The structural flexibility of NdhC and its ability to participate in different NDH-1 complex variants appears to be a key factor in allowing Nostoc punctiforme to rapidly acclimate to changing environmental conditions. Ongoing research using comparative transcriptomics and proteomics is identifying specific regulatory mechanisms that control NdhC expression and NDH-1 complex assembly under different stress conditions.

How might synthetic biology approaches utilize engineered NdhC to enhance photosynthetic efficiency?

Synthetic biology approaches targeting NdhC offer promising strategies for enhancing photosynthetic efficiency in both native cyanobacteria and heterologous systems. Several approaches are being explored:

• Optimized cyclic electron flow: Engineering NdhC and NDH-1 complexes to enhance cyclic electron flow could improve ATP/NADPH ratios, addressing a common limitation in photosynthetic productivity under fluctuating light conditions.

• Enhanced carbon concentration mechanisms: Since NDH-1 complexes containing NdhC contribute to CO2 uptake systems in cyanobacteria , optimizing these components could improve carbon fixation efficiency, particularly under limited CO2 availability.

• Heterologous expression in plants: Introducing engineered cyanobacterial NDH-1 components into chloroplasts could enhance cyclic electron flow in C3 plants, potentially improving their performance under high light or drought conditions.

• Bioenergetic scaffolding: Using NdhC as part of synthetic membrane protein scaffolds could enable the organization of bioenergetic complexes into more efficient arrangements, improving electron transfer rates and reducing energy losses.

These approaches require detailed understanding of NdhC structure-function relationships and careful optimization to avoid disrupting the delicate balance of photosynthetic electron transport. Initial efforts have focused on model organisms like Synechocystis sp. PCC 6803 before translation to more challenging systems like Nostoc punctiforme with its complex developmental cycles and symbiotic capabilities.