Recombinant Nostoc punctiforme Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ycf4; Npun_F3638; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Target Names
ycf4
Target Protein Sequence
MTTSTTINKGDRLLHQNVLGSRRFSNYWWATIVTLGASGFLLAGISSYLKVNLLIVSDPT QLVFVPQGLVMGLYGAAGLLLATYLWLVILLDVGGGYNEFNQETGTIKIFRWGFPGKNRR IEIDSRIEDVQSVRIAVKEGLNPIRALYLRIKGRRDIPLTRVGQPLSLTELETEGAKLAR FLGVSLEGL
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Database Links
Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How conserved is Ycf4 across different photosynthetic organisms?

    Ycf4 is highly conserved across photosynthetic organisms. The deduced amino acid sequence of Ycf4 from Chlamydomonas reinhardtii (197 residues) displays 41-52% sequence identity with homologues from other algae, land plants, and cyanobacteria like Nostoc punctiforme . This conservation suggests a fundamental role in oxygenic photosynthesis that has been maintained throughout evolution. The protein's C-terminal region shows particularly high conservation, indicating its functional importance in protein-protein interactions during PSI assembly.

  • What phenotypes are observed in Ycf4-deficient mutants?

    Complete knockout of Ycf4 results in severe phenotypic abnormalities:

    OrganismPhenotype in Δycf4 MutantsPhotosynthetic CapacityGrowth Characteristics
    TobaccoLight green leaves becoming pale yellow with ageUnable to perform photosynthesisCannot grow photoautotrophically; requires ≥1.5% sucrose for survival
    ChlamydomonasHigh-fluorescence phenotypeDeficient in PSI activityRequires acetate for growth
    Nostoc punctiformeNot specifically described in the search resultsPresumed PSI deficiencyNot specifically described

    Ultrastructural studies using transmission electron microscopy (TEM) reveal that chloroplasts in Ycf4 knockout plants exhibit significant structural abnormalities, including altered shape (rounded vs. oblong in wild-type), reduced size, disordered thylakoid membrane stacking, and the appearance of vesicular structures .

Advanced Research Questions

  • What specific amino acid residues are critical for Ycf4 function?

    Site-directed mutagenesis studies have identified several key residues essential for Ycf4 function:

    ResidueLocationMutationEffect on Ycf4Effect on PSI
    R120Hydrophilic domainR120A, R120QReduced stability; accumulation at 20% of wild-type levelNo effect on PSI when Ycf4 accumulation >20% of wild-type
    E179C-terminal hydrophilic domainE179AReduced accumulation (50% of wild-type)No significant effect
    E179C-terminal hydrophilic domainE179QLittle effect on stability or functionLittle effect
    E181C-terminal hydrophilic domainE181AReduced accumulation (30% of wild-type)Decreased by 60%
    E181C-terminal hydrophilic domainE181QLittle effect on stability or functionLittle effect

    These findings suggest that R120 is primarily important for Ycf4 stability, while E181 plays a more direct role in PSI assembly or accumulation.

  • How does the C-terminal domain of Ycf4 contribute to its function?

    The C-terminal domain of Ycf4 is crucial for its function. In-silico protein-protein interaction studies reveal that the C-terminus (91 amino acids) of Ycf4 interacts strongly with various photosynthetic proteins, including PSI subunits (PsaB, PsaC, PsaH), light-harvesting complex proteins, and RuBisCO subunits .

    Experimental evidence supports this computational prediction: partial deletion of Ycf4 (removing only the N-terminal 93 amino acids while preserving the C-terminal 91 amino acids) results in mutants that can still grow photoautotrophically, whereas complete deletion of Ycf4 produces plants that cannot survive without an external carbon source . This indicates that the C-terminal domain contains essential functional elements for protein-protein interactions during PSI assembly.

  • What is the relationship between Ycf4 abundance and PSI assembly efficiency?

    Interestingly, Ycf4 accumulates in excess of what is strictly required for PSI assembly. Studies show that wild-type cells accumulate at least 5-fold more Ycf4 than is necessary for normal PSI complex synthesis under laboratory conditions .

    Even when Ycf4 levels are reduced to 20% of wild-type levels (as in R120A and R120Q mutants), PSI reaction center proteins like PsaA still accumulate at wild-type levels . This apparent super-abundance of Ycf4 may serve as a buffering mechanism to ensure efficient PSI assembly under variable or stressful environmental conditions.

  • How does Ycf4 function differ between cyanobacteria and higher plants?

    The role of Ycf4 appears to differ in importance across photosynthetic organisms:

    OrganismEffect of Ycf4 DeletionPSI AssemblyPhotoautotrophic Growth
    Tobacco (higher plant)Complete prevention of PSI assemblySeverely impairedImpossible
    Chlamydomonas (green alga)Prevention of stable PSI accumulationSeverely impairedImpossible
    CyanobacteriaReduction but not elimination of PSI assemblyPartially functionalPossible with limitations

    This suggests an evolutionary divergence in the degree of dependence on Ycf4 for PSI assembly, with higher plants having developed a stricter requirement for this assembly factor compared to cyanobacteria.

Experimental Methodologies

  • What techniques are most effective for studying Ycf4-dependent PSI assembly?

    Multiple complementary approaches have proven effective for investigating Ycf4 function:

    TechniqueApplicationKey Insights
    Gene disruption (knockout)Determine essentialityComplete knockout in tobacco prevents photoautotrophic growth
    Site-directed mutagenesisIdentify critical residuesR120, E179, E181 are important for stability and function
    TAP-taggingPurify protein complexesIsolation of Ycf4-containing complex >1500 kDa
    Transmission electron microscopyExamine ultrastructureRevealed structural anomalies in chloroplasts of Δycf4 plants
    Transcriptome analysisAssess broader impactsRevealed Ycf4 affects expression of rbcL, LHC genes
    In-silico protein-protein interactionPredict functional domainsC-terminus important for interaction with photosynthetic proteins
    Pulse-chase labelingAssess protein synthesis/stabilityReduced labeling of PSI core proteins in ycf4 mutants
    Polysome analysisEvaluate translationReduced polysome association of psaB mRNA in tab2 mutant

    A multi-faceted approach combining these techniques provides the most comprehensive understanding of Ycf4 function.

  • How can researchers effectively purify and characterize Ycf4-containing complexes?

    The successful purification and characterization of Ycf4-containing complexes requires specialized approaches:

    1. TAP-tagging strategy: Adding a tandem affinity purification tag to the C-terminus of Ycf4 enables isolation of intact complexes. This approach has successfully yielded a large Ycf4-containing complex (>1500 kDa) .

    2. Gentle solubilization conditions: Use mild detergents like n-dodecyl-β-D-maltoside to maintain complex integrity during membrane protein extraction.

    3. Multi-step purification: Sequential chromatography steps (affinity, ion exchange, size exclusion) help achieve high purity.

    4. Analytical techniques:

      • N-terminal amino acid sequencing

      • Immunoblot analysis

      • Mass spectrometry for protein identification

      • Transmission electron microscopy and single particle analysis for structural characterization

    These approaches have revealed that Ycf4 associates with a complex containing multiple PSI polypeptides, potentially representing an intermediate assembly subcomplex of PSI.

  • What are the best approaches for generating and analyzing Ycf4 mutants?

    Creating and analyzing Ycf4 mutants requires careful consideration of several factors:

    1. Transformation strategy: For chloroplast-encoded Ycf4 (as in tobacco and Chlamydomonas), biolistic transformation with a chloroplast selectable marker cassette has proven effective .

    2. Selection considerations: Since complete Ycf4 knockouts cannot grow photoautotrophically, selection media must include an appropriate carbon source (e.g., acetate for Chlamydomonas, sucrose for tobacco) .

    3. Homoplasmy confirmation: PCR and Southern blot analysis are essential to confirm complete replacement of wild-type copies in all chloroplast genomes .

    4. Growth conditions: Light intensity modulation is important; lower light conditions (30 μmol m⁻² s⁻¹) can help maintain more stable phenotypes in Ycf4 mutants by reducing photooxidative stress .

    5. Phenotypic analyses:

      • Photosynthetic rate measurements

      • Chlorophyll content quantification

      • Protein accumulation analysis via immunoblotting

      • Ultrastructural studies via electron microscopy

      • Physiological parameters (transpiration rate, stomatal conductance, etc.)

    6. Domain-specific mutations: Consider creating both complete knockouts and partial deletions/mutations to identify domain-specific functions .

Data Interpretation and Experimental Design

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.