Recombinant Nostoc punctiforme UPF0754 membrane protein Npun_R4433 (Npun_R4433)

Shipped with Ice Packs
In Stock

Description

General Information

CategoryDescription
NameRecombinant Full Length Nostoc punctiforme UPF0754 membrane protein Npun_R4433 (Npun_R4433) Protein, His-Tagged
SourceNostoc punctiforme
SynonymsNpun_R4433; UPF0754 membrane protein Npun_R4433
UniProt IDB2IUM6
Amino Acid Length411
TagHis
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
AA SequenceMDWSHLWLYVSPPVLGGIIGYFTNDIAIKMLFRPYQAIYIAGRRVPFTPGLIPRNQERLALNISKTIMGSLLTPQELQNLARRLLQTERVQAAILWLLRLAIEQINTEKNEKSAKIVAGILRDLLGESLPRLLKVLARREDFLEAQINQIFDQILLEFQLSEEQATRLADWLLEVVLPPDMLRQAIVDFLTDRTIQIIDEGFREKTSGTYWVVANLFGLRNTLTRLRTFCLDEKEATNNRLQELTQDLQIRERIRKFLQNLSLQNLPMGTVRQLRKTTRESVRHYLQNSGSDFLQGLTDSVDWENIAVVLLNRLSTSSVVSTSLEVMSQELALILDKYLEKDLEIIVAQAIPILSIDQVIVDRVKSTSPADLEAAIEGIVKNELQAIVTLGGVLGFVIGLLQTVFLVLSQY

Biological Context

Npun_R4433 is found in Nostoc punctiforme, a filamentous cyanobacterium known for its symbiotic relationships with various plants . Nostoc punctiforme establishes symbioses with plants such as hornworts, where it plays a role in nitrogen fixation, providing the plant with a usable form of nitrogen . The genes and proteins involved in the establishment and maintenance of these symbiotic relationships have been a topic of research .

Functional Characterization

As a UPF0754 membrane protein, Npun_R4433 belongs to a protein family with currently unknown function . Membrane proteins are crucial for various cellular processes, including transport, signaling, and maintaining cell structure . Further research is needed to elucidate the specific role of Npun_R4433 in Nostoc punctiforme.

Recombinant Production and Applications

Recombinant Npun_R4433 is produced in E. coli and tagged with His to facilitate purification . The recombinant protein can be used for various biochemical and biophysical studies, such as antibody production, protein interaction studies, and structural analysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Npun_R4433; UPF0754 membrane protein Npun_R4433
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-411
Protein Length
full length protein
Species
Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Target Names
Npun_R4433
Target Protein Sequence
MDWSHLWLYVSPPVLGGIIGYFTNDIAIKMLFRPYQAIYIAGRRVPFTPGLIPRNQERLA LNISKTIMGSLLTPQELQNLARRLLQTERVQAAILWLLRLAIEQINTEKNEKSAKIVAGI LRDLLGESLPRLLKVLARREDFLEAQINQIFDQILLEFQLSEEQATRLADWLLEVVLPPD MLRQAIVDFLTDRTIQIIDEGFREKTSGTYWVVANLFGLRNTLTRLRTFCLDEKEATNNR LQELTQDLQIRERIRKFLQNLSLQNLPMGTVRQLRKTTRESVRHYLQNSGSDFLQGLTDS VDWENIAVVLLNRLSTSSVVSTSLEVMSQELALILDKYLEKDLEIIVAQAIPILSIDQVI VDRVKSTSPADLEAAIEGIVKNELQAIVTLGGVLGFVIGLLQTVFLVLSQY
Uniprot No.

Target Background

Database Links
Protein Families
UPF0754 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Nostoc punctiforme UPF0754 membrane protein Npun_R4433?

Npun_R4433 is a membrane protein belonging to the UPF0754 family found in the filamentous cyanobacterium Nostoc punctiforme (strain ATCC 29133 / PCC 73102). The protein is identified by the UniProt accession number B2IUM6 and is associated with the gene designated as Npun_R4433 in the Nostoc punctiforme genome. As a membrane protein, it is integrated within the cell membrane structure, suggesting its potential role in cellular processes that involve membrane dynamics or interactions . The protein's classification as an "UPF" (Uncharacterized Protein Family) indicates that while its sequence is recognized, its precise function remains to be fully elucidated through detailed molecular and functional analyses.

What expression systems are available for recombinant Npun_R4433 production?

Recombinant Npun_R4433 can be produced using multiple expression systems, each offering distinct advantages for different research applications. Currently available expression platforms include yeast, E. coli, baculovirus, and mammalian cell systems. The E. coli-based expression system (product code CSB-EP450534NHQ1) offers advantages for high-yield production, while mammalian cell systems (CSB-MP450534NHQ1) may provide superior post-translational modifications that more closely resemble the native protein configuration . Additionally, a specially modified version with Avi-tag biotinylation (CSB-EP450534NHQ1-B) is available, where biotin is covalently attached to the AviTag peptide through in vivo biotinylation using E. coli biotin ligase (BirA) technology. This creates an amide linkage between biotin and a specific lysine residue in the AviTag, facilitating protein detection and purification applications .

How does Npun_R4433 relate to the broader context of Nostoc punctiforme biology?

While the precise function of Npun_R4433 has not been definitively characterized, contextual evidence from related studies suggests potential involvement in membrane-associated processes critical to Nostoc punctiforme biology. Nostoc punctiforme is known for its ability to form specialized filaments called hormogonia, which serve as infective units in establishing symbiotic relationships with plants . The cyanobacterium possesses a type IV piliation system that contributes significantly to this symbiotic competency. Although Npun_R4433 is not directly mentioned in the piliation studies, as a membrane protein, it may contribute to membrane organization, cell-surface interactions, or signaling processes that support these specialized functions. Understanding Npun_R4433 could potentially provide insights into the molecular mechanisms underlying Nostoc punctiforme's complex interactions with plant hosts and environmental adaptation strategies .

What methodological approaches are recommended for purifying recombinant Npun_R4433?

Purification of recombinant Npun_R4433 requires strategies optimized for membrane proteins. Based on general principles for similar proteins, a multi-step approach is recommended. Initially, affinity chromatography using the protein's tag (which may vary depending on the expression construct) can be employed for primary capture. For proteins expressed with histidine tags, researchers should consider a gradient elution with increasing imidazole concentration (typically 20-500 mM) to distinguish between non-specific binding and true target protein binding . This is particularly important for ensuring isolation of full-length protein rather than truncated products.

For membrane proteins like Npun_R4433, incorporation of appropriate detergents during purification is critical. A recommended approach is to screen mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin at concentrations slightly above their critical micelle concentration. Following affinity chromatography, size exclusion chromatography (SEC) can further separate the protein from contaminants and aggregates while maintaining it in a detergent-solubilized state.

The target purity for research applications should exceed 85% as assessed by SDS-PAGE analysis, consistent with commercial preparations of the protein . For structural studies, additional purification steps such as ion exchange chromatography may be necessary to achieve >95% purity.

What are the primary challenges in expressing full-length Npun_R4433 and how can they be addressed?

Expression of full-length Npun_R4433 faces several challenges common to membrane proteins. These include protein hydrophobicity, codon usage issues, and potential toxicity to host cells . To address these challenges, researchers should implement the following strategies:

  • Codon optimization: The gene sequence should be optimized for the chosen expression host to prevent translation stalling due to rare codons. This is particularly important when expressing cyanobacterial proteins in heterologous systems.

  • Expression vector selection: Vectors with tightly regulated promoters (such as T7lac for E. coli systems) allow control over expression timing and intensity, reducing potential toxicity issues.

  • Fusion tags: N-terminal fusion partners such as maltose-binding protein (MBP) or NusA can enhance solubility of the recombinant protein.

  • Expression monitoring: Employing dual tags (N and C-terminal) can help identify truncated products during expression, allowing optimization of expression conditions.

  • Membrane extraction: For proper characterization of Npun_R4433, specialized extraction methods using detergent panels should be employed to maintain native conformation.

The experimental design should include pilot expression tests with multiple conditions, varying parameters such as induction temperature (16-30°C), inducer concentration, and harvest timing to identify optimal expression conditions .

How can researchers assess potential protein-protein interactions involving Npun_R4433?

Investigating protein-protein interactions involving Npun_R4433 requires specialized approaches accounting for its membrane-associated nature. Researchers should consider implementing:

  • Co-immunoprecipitation (Co-IP): Using antibodies against Npun_R4433 or its fusion tag to pull down potential interaction partners, followed by mass spectrometry identification. Based on successful approaches with other membrane proteins, mild detergents like digitonin (0.5-1%) or DDM (0.1-0.5%) should be incorporated in lysis buffers to maintain protein-protein interactions while solubilizing membrane components .

  • Proximity labeling techniques: BioID or APEX2 fusion constructs with Npun_R4433 can label proximal proteins in vivo, providing spatial interaction information that is particularly valuable for membrane proteins.

  • Microscale thermophoresis (MST): This technique is suitable for quantifying binding affinities between purified Npun_R4433 and potential partners in detergent micelles.

  • Split reporter systems: Protein-fragment complementation assays using split GFP or luciferase can verify specific interactions in heterologous expression systems.

Studies investigating other Nostoc proteins have successfully employed two-way co-immunoprecipitation to confirm protein interactions, which represents a validated methodological approach applicable to Npun_R4433 research .

What experimental approaches can determine the membrane topology of Npun_R4433?

Determining the membrane topology of Npun_R4433 requires systematic experimental approaches that can map the orientation and positioning of protein domains relative to the membrane. Recommended methodologies include:

  • Cysteine accessibility methods: By introducing cysteine residues at various positions throughout the protein sequence and then assessing their accessibility to membrane-impermeable sulfhydryl reagents, researchers can map regions exposed to either side of the membrane.

  • Protease protection assays: Treating membrane preparations containing Npun_R4433 with proteases such as trypsin or proteinase K can help identify protected domains (embedded in or facing the membrane interior) versus exposed regions.

  • Fluorescence-based approaches: Creating fusion constructs with fluorescent proteins or epitope tags at either terminus or within predicted loops, then assessing their accessibility through antibody binding or fluorescence quenching experiments.

  • Computational prediction validation: While computational tools provide initial topology predictions, experimental validation is essential. Researchers should compare experimental results with predictions from multiple topology prediction algorithms such as TMHMM, TOPCONS, and Phobius to develop a consensus model of Npun_R4433 membrane insertion.

The combined application of these approaches has successfully elucidated the topology of other cyanobacterial membrane proteins and represents the most robust strategy for characterizing Npun_R4433's arrangement within the membrane.

How might Npun_R4433 contribute to Nostoc punctiforme symbiotic capabilities?

While direct evidence linking Npun_R4433 to symbiotic functions is currently limited, several hypotheses can be formed based on contextual information about Nostoc punctiforme's symbiotic mechanisms. Experimental approaches to investigate these potential connections include:

  • Gene knockout studies: Creating Npun_R4433 deletion mutants and assessing their symbiotic competency with plant partners such as Blasia. Similar approaches with other Nostoc genes have demonstrated that altered surface structures can significantly impact symbiotic establishment frequencies .

  • Localization during symbiosis: Fluorescently tagged Npun_R4433 constructs can help determine if the protein's distribution changes during hormogonium differentiation or plant infection stages. Studies have shown that pilus components are differentially expressed during these processes, and similar dynamics may occur with membrane proteins .

  • Comparative genomics: Analyzing the conservation and sequence variation of Npun_R4433 homologs across symbiotic and non-symbiotic cyanobacterial species could provide insights into potential symbiosis-specific adaptations.

  • Transcriptomic analysis: Quantifying Npun_R4433 expression changes during hormogonium formation and plant infection stages. Previous studies have shown that transcripts for certain pilus components increase during hormogonium formation, suggesting coordinated expression of factors involved in symbiotic processes .

The research approach should incorporate assessment of infection frequency using methods similar to those employed for other Nostoc mutants, where a statistically significant reduction in symbiotic competency would suggest functional relevance of Npun_R4433 in this process.

What quality control measures should be implemented when working with recombinant Npun_R4433?

Ensuring the quality and integrity of recombinant Npun_R4433 preparations requires comprehensive quality control measures. Researchers should implement the following validated approaches:

  • Purity assessment: SDS-PAGE analysis should demonstrate >85% purity as the minimum acceptable threshold for most research applications, with Coomassie or silver staining to visualize protein bands .

  • Identity confirmation: Western blotting using antibodies against the protein or its fusion tags, coupled with mass spectrometry analysis to verify the protein sequence and post-translational modifications.

  • Structural integrity evaluation: Circular dichroism (CD) spectroscopy can assess secondary structure content, which should be consistent with predictions based on the protein sequence. Thermal shift assays can provide information about protein stability and proper folding.

  • Functional verification: While the precise function of Npun_R4433 remains to be fully characterized, examining properties such as oligomerization state (using techniques such as size exclusion chromatography coupled with multi-angle light scattering) or lipid binding (using lipid overlay assays or liposome binding experiments) can provide insights into functional integrity.

  • Homogeneity assessment: Dynamic light scattering (DLS) or analytical ultracentrifugation to confirm protein homogeneity and absence of significant aggregation.

For proteins supplied as lyophilized powder, proper reconstitution is critical. Researchers should centrifuge vials before opening to ensure the powder is at the bottom, then reconstitute in deionized sterile water or an appropriate buffer system optimized for membrane proteins .

What are the optimal storage conditions for maintaining Npun_R4433 stability and activity?

Maintaining the stability and activity of Npun_R4433 requires careful consideration of storage conditions, particularly given its nature as a membrane protein. Based on established practices for similar proteins, the following recommendations should be implemented:

Short-term storage (1-2 weeks):

  • Store at 4°C in a buffer containing appropriate detergent at concentrations slightly above CMC

  • Include stabilizing agents such as glycerol (10-20%)

  • Maintain protective antioxidants such as DTT (1-2 mM) or TCEP (0.5-1 mM)

  • Consider adding protease inhibitors to prevent degradation

Long-term storage:

  • Aliquot the protein to minimize freeze-thaw cycles

  • For lyophilized preparations, store at -20°C in a desiccator

  • For solution preparations, store at -80°C with 25-50% glycerol as cryoprotectant

  • Before freezing, flash-freeze aliquots in liquid nitrogen to minimize ice crystal formation

Stability monitoring:

  • Periodically check protein stability using techniques such as SDS-PAGE or size exclusion chromatography

  • For critical applications, verify functional integrity after extended storage periods

Researchers should be aware that membrane proteins are generally more susceptible to denaturation during freeze-thaw cycles compared to soluble proteins. Therefore, repeated freezing and thawing should be strictly avoided, and working aliquots should be prepared when possible .

How can Npun_R4433 research contribute to understanding cyanobacterial-plant symbiosis mechanisms?

Research on Npun_R4433 has significant potential to advance understanding of cyanobacterial-plant symbiotic relationships through several key approaches:

  • Comparative studies with known symbiosis factors: Investigating potential functional relationships between Npun_R4433 and established symbiosis determinants such as the pilus components in Nostoc punctiforme could reveal coordinated mechanisms. Research has demonstrated that mutations in pil-like genes significantly altered surface piliation and reduced symbiotic competency, establishing a clear link between surface structures and symbiotic capability .

  • Symbiosis model systems: Utilizing the Nostoc-Blasia symbiosis model to evaluate the impact of Npun_R4433 modifications on infection frequency and colonization success. Previous studies have employed this approach successfully, showing that the NpR0117 (hyperpiliated) mutant infected Blasia tissue at considerably lower frequencies than wild-type, indicating that normal surface properties are critical for effective symbiosis establishment .

  • Integration with -omics approaches: Combining Npun_R4433 functional studies with transcriptomic, proteomic, and metabolomic analyses during different stages of symbiosis could identify regulatory networks and signaling pathways involving this protein.

  • Host specificity investigation: Exploring whether Npun_R4433 contributes to Nostoc's ability to establish symbioses with different plant partners could provide insights into the molecular basis of host specificity, which remains an important question in plant-microbe interactions research.

The research data could ultimately contribute to developing strategies for enhancing beneficial plant-cyanobacteria associations in agricultural and ecological contexts, with potential applications in sustainable agriculture and ecosystem restoration.

What emerging technologies could accelerate understanding of Npun_R4433 function?

Several cutting-edge technologies and methodological approaches have the potential to significantly advance understanding of Npun_R4433 function:

  • Cryo-electron microscopy (cryo-EM): This technique can reveal the three-dimensional structure of membrane proteins in near-native conditions, potentially providing insights into Npun_R4433's arrangement within the membrane and identifying functional domains.

  • CRISPR-Cas9 genome editing in cyanobacteria: Refined CRISPR protocols for cyanobacteria enable precise genetic modifications, allowing creation of Npun_R4433 variants with specific mutations or tagged versions for in vivo studies.

  • Single-molecule tracking techniques: These approaches can monitor the dynamics and localization of fluorescently labeled Npun_R4433 within living cyanobacterial cells during various physiological states, including hormogonium differentiation and symbiotic interactions.

  • Artificial intelligence for protein function prediction: Machine learning approaches trained on large datasets of characterized proteins can generate testable hypotheses about Npun_R4433 function based on sequence features and structural predictions.

  • Native mass spectrometry: This technique can analyze membrane proteins and their complexes in their near-native state, potentially identifying interaction partners and post-translational modifications of Npun_R4433.

  • Microfluidics-based symbiosis models: These systems allow precise control and real-time imaging of cyanobacteria-plant interactions, enabling detailed investigation of Npun_R4433's role in these processes.

The integration of these advanced technologies with traditional biochemical and genetic approaches offers the most promising path toward comprehensive functional characterization of Npun_R4433 and its biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.