Recombinant Nostoc sp. ATP synthase protein I (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpI; atp1; all0011; ATP synthase protein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
atpI
Target Protein Sequence
MQEFYQLYQELVLITLVLTGVVFISVWIFYSLNIALNYLLGACTGVVYLRMLAKDVERLG REKQSLSKTRLALLMALILLASRWNQLQIMPIFLGFLTYKATLIIYVVRVAFISDSPKLR QP
Uniprot No.

Target Background

Function

This protein potentially plays a role in guiding the assembly of the membrane sector within the ATP synthase enzyme complex.

Database Links

KEGG: ana:all0011

STRING: 103690.all0011

Protein Families
Bacterial AtpI family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional relationship between atpI and other ATP synthase subunits in Nostoc sp.?

ATP synthase protein I (atpI) in Nostoc sp. functions as part of the F₀F₁ ATP synthase complex, which is critical for energy metabolism in cyanobacteria. The protein participates in the membrane-embedded F₀ portion of the complex, contributing to proton translocation across the thylakoid membrane. Based on studies of regulatory proteins like AtpΘ (formerly Norf1) in related cyanobacteria, ATP synthase subunits can interact with regulatory proteins that prevent wasteful ATP hydrolysis under unfavorable conditions . These interactions are likely relevant to atpI function as well, suggesting its role extends beyond structural support to potentially include regulatory mechanisms.

How is atpI conserved across cyanobacterial species compared to other ATP synthase components?

Analysis of cyanobacterial ATP synthase components shows varying degrees of conservation. While some ATP synthase regulatory proteins like AtpΘ demonstrate significant sequence divergence with only 7 widely conserved residues across different cyanobacterial species , structural subunits tend to show higher conservation. The conservation pattern of atpI follows functional constraints related to the assembly and operation of the ATP synthase complex. This divergence in regulatory components is reflected in properties such as isoelectric points, which range from acidic values in mesophilic strains to very alkaline values (>11) in thermophilic strains .

What is known about the genomic organization of the atp operon in Nostoc sp. PCC 7120?

The atp operon in Nostoc sp. PCC 7120 (also known as Anabaena sp. PCC 7120) contains genes encoding the various subunits of the ATP synthase complex. While specific details on the atpI gene position within the operon aren't provided in the available research, studies on related cyanobacteria indicate that regulatory factors of ATP synthase may be encoded separately from the main operon. For instance, the AtpΘ protein in Synechocystis sp. PCC 6803 was initially discovered through transcriptomic analysis as a novel open reading frame (Norf1) , suggesting complex genomic organization patterns for ATP synthase components that likely apply to Nostoc sp. as well.

What expression systems are most effective for recombinant Nostoc sp. atpI production?

For recombinant production of membrane proteins like atpI from Nostoc sp. PCC 7120, E. coli-based expression systems remain the standard approach, with BL21(DE3) and its derivatives being particularly suitable. When designing an expression strategy, consider these methodological elements:

  • Vector selection: pET series vectors with T7 promoters provide strong induction capabilities

  • Expression tags: N-terminal His₆-tags with TEV cleavage sites enable purification while allowing tag removal

  • Growth conditions: Initial expression at 37°C followed by temperature reduction to 18°C upon induction

  • Induction parameters: 0.1-0.5 mM IPTG concentration with extended expression periods (16-20 hours)

As membrane protein expression often results in inclusion bodies, solubilization strategies using mild detergents or fusion partners like MBP (maltose-binding protein) may enhance soluble protein yield.

What purification challenges are specific to recombinant atpI, and how can they be addressed?

Purification of recombinant atpI presents several challenges due to its membrane-associated nature:

ChallengeMethodological SolutionExpected Outcome
Membrane extractionDifferential centrifugation following cell lysisSeparation of membrane fractions where atpI resides
Protein solubilizationDetergent screening (DDM, LDAO, C₁₂E₈)Optimal protein extraction while maintaining structure
Purification specificityIMAC followed by size exclusion chromatographyHigh purity preparations suitable for structural studies
Protein stabilityAddition of lipids during purificationMaintenance of native-like environment for functionality

For functional studies, researchers should verify protein folding using circular dichroism and assess activity through ATP hydrolysis assays, similar to those used for studying ATP synthase regulatory proteins .

How can protein-protein interactions involving atpI be effectively studied?

Based on approaches used with other ATP synthase components, several complementary techniques can effectively characterize atpI interactions:

  • Immunoprecipitation coupled with mass spectrometry: This approach successfully identified interactions between AtpΘ and ATP synthase subunits in Synechocystis .

  • Far Western blotting: Useful for validating specific protein-protein interactions as demonstrated with other ATP synthase subunits .

  • Membrane fractionation: Can help localize atpI and identify co-localized interaction partners, as shown for AtpΘ being targeted to the thylakoid membrane .

  • Fluorescent protein fusions: GFP fusions can visualize subcellular localization and potentially interaction dynamics, similar to the approach with AtpΘ .

How do environmental conditions affect atpI expression and function in Nostoc sp.?

Environmental conditions significantly impact ATP synthase components in cyanobacteria like Nostoc sp. PCC 7120. Research indicates that unfavorable conditions trigger regulatory mechanisms for ATP synthase activity. For example, in Synechocystis, the regulatory protein AtpΘ is recruited during unfavorable conditions to prevent wasteful ATP hydrolysis . For atpI research, consider examining:

  • Nitrogen availability effects: Studies on Nostoc sp. PCC 7120 demonstrate profound metabolic shifts under nitrogen starvation, affecting protein expression patterns .

  • Salt stress responses: In transgenic Anabaena PCC 7120, salt stress triggers significant changes in transport protein function and protection mechanisms .

  • Light intensity variations: As photosynthetic organisms, Nostoc sp. likely modulates ATP synthase components in response to changing light conditions.

Experimental approaches should include quantitative proteomics under various conditions and functional assays measuring ATP synthesis/hydrolysis rates.

What methods are most reliable for measuring recombinant atpI activity in experimental settings?

For reliable measurement of recombinant atpI activity, researchers should employ multiple complementary approaches:

  • ATP hydrolysis assays: Measure ATPase activity in isolated membrane fractions or purified protein complexes under varying conditions, as performed for AtpΘ characterization .

  • Reconstitution into liposomes: Assess proton translocation capabilities using pH-sensitive fluorescent dyes.

  • Site-directed mutagenesis: Systematically modify conserved residues to establish structure-function relationships.

Data collection should include:

  • Initial reaction rates under different substrate concentrations

  • Inhibition profiles using known ATP synthase inhibitors

  • pH and temperature dependency profiles

How does recombinant atpI differ functionally from native protein in Nostoc sp.?

The functional comparison between recombinant and native atpI should consider several factors:

ParameterNative atpIRecombinant atpIMethodological Approach
Protein foldingNative membrane environmentDependent on expression system and purificationCircular dichroism, thermal stability assays
Post-translational modificationsSpecies-specific modificationsMay lack modificationsMass spectrometry analysis
Interaction capabilitiesComplete interactomePotentially alteredPull-down assays, co-immunoprecipitation
ActivityFully functional in complexOften reduced functionalityComparative enzymatic assays

To minimize differences, consider co-expression with other ATP synthase components or reconstitution with native lipid extracts from Nostoc sp.

How can atpI research contribute to understanding cyanobacterial adaptations to environmental stress?

ATP synthase regulation represents a critical adaptive mechanism in cyanobacteria facing environmental stressors. Research on atpI can provide insights into:

  • Energy conservation strategies: Under stress conditions, cyanobacteria must prevent wasteful ATP hydrolysis, as evidenced by the recruitment of inhibitory proteins like AtpΘ .

  • Metabolic coordination: ATP synthase function is integrated with nitrogen and carbon metabolism, which are tightly co-regulated in cyanobacteria .

  • Stress response networks: Proteomic studies of Nostoc sp. PCC 7120 under nitrogen starvation reveal extensive regulation of proteins involved in various metabolic pathways .

Experimental approaches should include comparative studies of wild-type and atpI-modified strains under various stress conditions, measuring growth, photosynthetic performance, and metabolic outputs.

What bioinformatic approaches can predict functional interactions of atpI with other proteins?

Advanced bioinformatic strategies for predicting atpI interactions include:

  • Homology modeling: Similar to approaches used for nrtACD proteins of Nostoc PCC 7120, where template search on the NCBI PDB database identified structural homologs for modeling .

  • Model validation: Using assessment tools like Ramachandran Plot (RAMPAGE), PROCHEK, and PDBSum to evaluate stereochemical quality .

  • Protein-protein docking: Predicting interaction interfaces with other ATP synthase components.

  • Evolutionary coupling analysis: Identifying co-evolving residues that may represent interaction interfaces.

Validation of predicted interactions should employ experimental approaches like site-directed mutagenesis of predicted interface residues followed by binding and functional assays.

How might the inhibitory mechanisms observed in AtpΘ apply to understanding atpI regulation and function?

The characterization of AtpΘ as an inhibitor of F₀F₁ ATP synthase to prevent wasteful ATP hydrolysis provides a conceptual framework for understanding potential regulatory mechanisms involving atpI:

  • Conditional recruitment: Like AtpΘ, regulatory factors interacting with atpI may be recruited under specific stress conditions.

  • Structural changes: Inhibitory interactions likely induce conformational changes affecting proton conductance through the F₀ portion.

  • Energetic regulation: The balance between ATP synthesis and hydrolysis is critical for cellular energetics and requires fine regulatory control.

Research approaches should include identification of proteins that interact with atpI under various conditions, characterization of interaction interfaces, and assessment of how these interactions affect ATP synthase function.

What are the most significant technical barriers in studying recombinant atpI, and how can they be overcome?

Research on recombinant atpI faces several technical challenges:

ChallengeSolution StrategyExpected Improvement
Low expression levelsCodon optimization for expression host2-5 fold increase in protein yield
Protein instabilityAddition of specific lipids during purificationEnhanced protein stability for longer experimental timeframes
Functional reconstitutionCo-expression with interacting subunitsMore native-like protein complexes
Structure determinationNanodiscs or amphipol stabilizationBetter samples for cryo-EM or crystallography

Researchers should implement systematic screening approaches to identify optimal conditions for their specific experimental goals.

How can researchers differentiate between direct and indirect effects when studying atpI function?

To distinguish direct from indirect effects in atpI functional studies:

  • In vitro reconstitution: Assemble minimal systems with purified components to assess direct effects without cellular complexity.

  • Complementation studies: Use defined mutants with precise complementation to isolate specific functions.

  • Time-resolved experiments: Rapid sampling following perturbation can separate primary from secondary effects.

  • Domain swapping: Exchange domains between atpI and homologs to map specific functions to protein regions.

Controls should include catalytically inactive mutants and careful assessment of ATP synthase assembly to ensure observed effects relate to function rather than structural defects.

What considerations are important when designing site-directed mutagenesis experiments for atpI?

When designing site-directed mutagenesis experiments for atpI, researchers should consider:

  • Conservation analysis: Focus on highly conserved residues identified through multiple sequence alignment of atpI across cyanobacterial species.

  • Structural context: Use homology models based on related proteins to predict the structural impact of mutations.

  • Biochemical properties: Consider replacing residues with amino acids of similar size but altered chemical properties to isolate functional effects.

  • Experimental validation: Confirm proper protein folding for each mutant before interpreting functional changes.

A systematic mutagenesis approach should target residues in different functional domains and include both conservative and non-conservative substitutions to develop a comprehensive understanding of structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.