Recombinant Nostoc sp. Cobalt transport protein CbiN (cbiN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbiN; alr3944; Cobalt transport protein CbiN; Energy-coupling factor transporter probable substrate-capture protein CbiN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
cbiN
Target Protein Sequence
MNQSKQSLSNWLLIGGVIALAVLPLIFVRDAEFTGADSQAEKAISEVKPGYEPWFKPLFE PPSGEVESLLFSSQAALGAGIIGYAVGLYKGRSQQQRHKE
Uniprot No.

Target Background

Function
This protein is part of the energy-coupling factor (ECF) transporter complex CbiMNOQ, which is involved in cobalt import.
Database Links

KEGG: ana:alr3944

STRING: 103690.alr3944

Protein Families
CbiN family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Nostoc sp. cobalt transport protein CbiN and what is its biological function?

The cobalt transport protein CbiN is a component of the cobalt uptake system in Nostoc sp., a genus of cyanobacteria. This protein plays a critical role in the transport of cobalt ions across the cell membrane, which is essential for various metabolic processes, particularly the biosynthesis of vitamin B12 (cobalamin). Similar to how researchers have studied other proteins in Nostoc, the CbiN protein likely functions as part of a larger transport complex that helps maintain metal ion homeostasis within the cell .

Unlike some other cyanobacterial proteins that may have been acquired through horizontal gene transfer, the cobalt transport system is generally considered a core component of cellular machinery. The transport of cobalt is particularly important in cyanobacteria like Nostoc that inhabit extreme environments such as Antarctic regions, where mineral availability may be limited .

What expression systems are recommended for producing recombinant Nostoc sp. CbiN protein?

Based on successful expression of other Nostoc proteins, Escherichia coli BL21(DE3) is a recommended expression system for recombinant CbiN production. This system has been effectively used to express other recombinant proteins from Nostoc species . The protocol typically involves:

  • Cloning the cbiN gene into an appropriate expression vector

  • Transforming E. coli BL21(DE3) with the recombinant plasmid

  • Inducing protein expression using IPTG at 0.5 mM concentration

  • Allowing expression to proceed overnight at 16°C to enhance proper protein folding

For optimal results, consider using a dual-induction system with IPTG (0.5 mM) and arabinose (0.2%) if co-expression with other proteins is necessary, as this approach has yielded successful results with other Nostoc proteins .

What purification methods are most effective for recombinant CbiN?

For purification of recombinant CbiN protein from Nostoc sp., a multi-step purification protocol is recommended:

  • Initial capture using immobilized metal affinity chromatography (IMAC) if the protein contains a His-tag

  • Removal of imidazole using desalting columns such as PD10 columns

  • Concentration of purified protein using Vivaspin columns for subsequent analysis

After purification, it is important to verify protein integrity and molecular weight using SDS-PAGE analysis. Based on similar proteins from Nostoc, you can expect the molecular weight to correspond closely to the predicted value from the amino acid sequence .

How should RNA extraction and quantitative RT-PCR be optimized for studying cbiN gene expression in Nostoc sp.?

To study cbiN gene expression in Nostoc sp., follow these optimized procedures for RNA extraction and qRT-PCR:

  • RNA Extraction:

    • Extract RNA using methods previously validated for cyanobacteria

    • Remove chromosomal DNA contamination with 1 μl of DNAse (2 U/μl) treatment for 1 hour at 37°C

    • Verify RNA concentration spectrophotometrically

  • Reverse Transcription:

    • Denature 500 ng of total RNA with random hexamer primers at 95°C

    • Prepare a reaction mix containing 5× buffer, RNase Inhibitor, 5 mM dNTPs, and MMLV reverse transcriptase (200 U/μl)

    • Incubate for 1 hour at 45°C

  • Quantitative PCR:

    • Use GoTaq qPCR Master Mix with SYBR Green I Dye

    • Design primers specific to cbiN with approximately 500 nM final concentration

    • Dilute cDNA 25× for use as template

    • Perform PCR in triplicate using a qPCR system such as CFX96

    • Analyze data using the delta Ct method, considering only reactions with over 80% efficiency

When designing primers, ensure they target regions that will not be affected by any genetic modifications you may have introduced into the strain.

What approaches can be used to investigate the role of CbiN in cobalt transport under different environmental conditions?

To investigate CbiN's role in cobalt transport under varying environmental conditions, consider these methodological approaches:

  • Gene Knockout Studies:

    • Create a cbiN mutant strain using insertion of an antibiotic resistance cassette

    • Compare growth of wild-type and mutant strains under different cobalt concentrations

    • Introduce the cbiN gene via a replicative plasmid for complementation studies to confirm phenotypic restoration

  • Growth Condition Experiments:

    • Culture Nostoc sp. under different environmental stressors (temperature variation, nutrient limitation, metal stress)

    • Monitor growth curves using spectrophotometric methods

    • Compare cobalt uptake between wild-type and mutant strains using atomic absorption spectroscopy

  • Gene Expression Analysis:

    • Perform qRT-PCR on cbiN under various growth conditions

    • Identify potential transcriptional regulators by analyzing upstream regions

    • Investigate whether expression is dependent on global transcriptional regulators (similar to how pkn22 depends on NtcA)

Table 1: Example experimental design for investigating CbiN function under different cobalt concentrations

Growth ConditionStrains to CompareMeasurementsExpected Outcomes
No added cobaltWild-type, ΔcbiN mutant, complemented strainGrowth rate, Heterocyst frequency, Cobalt contentReduced growth in mutant if CbiN is essential
Low cobalt (1 μM)Wild-type, ΔcbiN mutant, complemented strainGrowth rate, Cobalt uptake ratePartial growth restoration
High cobalt (10 μM)Wild-type, ΔcbiN mutant, complemented strainGrowth rate, Toxicity indicatorsPossible toxicity in wild-type if CbiN causes excess uptake
Cobalt + competing metalsWild-type, ΔcbiN mutantSelective metal uptakeTransport specificity data

How can protein-protein interactions between CbiN and other components of the cobalt transport system be characterized?

Characterizing protein-protein interactions between CbiN and other components of the cobalt transport system requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express recombinant CbiN with an affinity tag (e.g., His-tag)

    • Use the tagged protein as bait to pull down interacting partners

    • Identify interaction partners through mass spectrometry

  • Bacterial Two-Hybrid System:

    • Clone cbiN and potential interacting genes into appropriate vectors

    • Co-transform into a reporter strain

    • Quantify interaction strength through reporter gene expression

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified CbiN on a sensor chip

    • Flow potential interacting proteins over the surface

    • Measure binding kinetics and affinity constants

  • Crosslinking Mass Spectrometry:

    • Use chemical crosslinkers to stabilize transient interactions

    • Digest crosslinked complexes and analyze by tandem mass spectrometry

    • Identify specific interaction domains through crosslinked peptides

When analyzing results, consider that the CbiN protein may function as part of a larger cobalt transport complex, similar to how other transport systems operate in cyanobacteria. Interpretation of interaction data should account for the native membrane environment of this transport protein.

What structural features of CbiN contribute to cobalt specificity and transport mechanism?

Understanding the structural features of CbiN that contribute to cobalt specificity requires sophisticated structural biology approaches:

  • Protein Structure Determination:

    • X-ray crystallography of purified CbiN

    • Cryo-electron microscopy for membrane-embedded CbiN complex

    • NMR spectroscopy for dynamic regions

  • Computational Structure Analysis:

    • Identify conserved metal-binding motifs through sequence alignment

    • Predict metal-binding sites using specialized algorithms

    • Perform molecular dynamics simulations to model cobalt interactions

  • Site-Directed Mutagenesis:

    • Mutate predicted cobalt-binding residues (typically histidine, cysteine, methionine)

    • Express mutant proteins and assess cobalt binding capacity

    • Determine functional consequences through transport assays

  • Spectroscopic Approaches:

    • Use X-ray absorption spectroscopy to characterize the coordination environment of bound cobalt

    • Apply circular dichroism to assess conformational changes upon cobalt binding

    • Employ fluorescence spectroscopy with labeled protein to track structural transitions

The results from these approaches should be integrated to develop a comprehensive model of how CbiN achieves selectivity for cobalt over other divalent metals, considering that metal transport proteins typically contain specific coordination geometries optimized for their target ions.

How do horizontal gene transfer events influence the evolution of cobalt transport systems in different Nostoc species?

Investigating the evolutionary history of cobalt transport systems in Nostoc species through horizontal gene transfer events requires:

  • Comparative Genomic Analysis:

    • Sequence cbiN genes from multiple Nostoc species and related cyanobacteria

    • Construct phylogenetic trees to identify potential horizontal transfer events

    • Compare genomic contexts around cbiN to identify conserved operons or gene clusters

  • Sequence-Based Evidence Assessment:

    • Analyze GC content and codon usage patterns of cbiN genes

    • Compare with genomic averages to identify potential foreign origin

    • Search for mobile genetic elements in proximity to cobalt transport genes

  • Functional Characterization Across Species:

    • Express CbiN proteins from different Nostoc species

    • Compare biochemical properties and substrate specificities

    • Assess functional complementation in heterologous systems

This approach is supported by findings in other Nostoc proteins, such as ice-binding proteins (IBPs), which show evidence of horizontal gene transfer from other bacterial species, allowing adaptation to extreme environments .

What challenges might arise when expressing membrane proteins like CbiN, and how can they be addressed?

Expressing membrane proteins like CbiN presents several challenges that require specific methodological solutions:

  • Protein Misfolding and Inclusion Body Formation:

    • Challenge: Membrane proteins often aggregate in heterologous systems

    • Solution: Lower induction temperature to 16°C, use lower IPTG concentrations (0.1-0.5 mM), and extend induction time (overnight)

    • Alternative: Use specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Toxicity to Host Cells:

    • Challenge: Overexpression of transport proteins can disrupt host cell membrane integrity

    • Solution: Use tightly controlled inducible systems and consider using cell-free expression systems

    • Alternative: Express CbiN with fusion partners that reduce toxicity

  • Purification Difficulties:

    • Challenge: Maintaining protein stability during extraction from membranes

    • Solution: Use mild detergents (DDM, LMNG) for solubilization

    • Validation: Verify function after purification using cobalt binding assays

  • Proper Insertion into Membranes:

    • Challenge: Ensuring correct topology in the membrane

    • Solution: Consider using GFP fusion constructs to monitor proper folding

    • Validation: Use protease accessibility assays to confirm membrane topology

When optimizing CbiN expression, it's advisable to start with small-scale expression trials to identify optimal conditions before scaling up to larger cultures for purification purposes.

How can researchers distinguish between specific cobalt transport by CbiN and non-specific metal binding?

Distinguishing between specific cobalt transport mediated by CbiN and non-specific metal binding requires carefully designed experiments:

  • Competitive Metal Binding Assays:

    • Incubate purified CbiN with cobalt in the presence of competing metals (nickel, zinc, iron)

    • Measure bound cobalt using inductively coupled plasma mass spectrometry (ICP-MS)

    • Calculate metal selectivity ratios to quantify specificity

  • Transport Kinetics Analysis:

    • Measure cobalt uptake rates at different concentrations

    • Determine Km and Vmax values for cobalt transport

    • Compare kinetic parameters in the presence of competing metals

  • Isothermal Titration Calorimetry (ITC):

    • Perform binding experiments with different metals

    • Compare thermodynamic parameters (ΔH, ΔS, Kd)

    • Specific binding typically shows distinct thermodynamic signatures

  • Functional Complementation Studies:

    • Express CbiN in a heterologous system lacking endogenous cobalt transporters

    • Test growth restoration under cobalt limitation

    • Assess whether other metals can substitute functionally

Table 2: Methods to assess metal specificity of CbiN protein

MethodMeasurementAdvantageLimitation
ICP-MSDirect metal quantificationHigh sensitivityRequires specialized equipment
Radioisotope uptakeTransport kineticsDynamic measurements possibleSafety concerns with radioisotopes
Fluorescent metal probesReal-time bindingCan be used in live cellsPotential interference from probe
ITCThermodynamic parametersProvides binding mechanism insightsRequires significant protein amounts
Functional complementationPhysiological relevanceConfirms biological functionIndirect measurement

What statistical approaches are appropriate for analyzing gene expression data for cbiN under different experimental conditions?

When analyzing gene expression data for cbiN under various experimental conditions, consider these statistical approaches:

  • Normalization Strategies:

    • Use multiple reference genes that remain stable under your experimental conditions

    • Apply geometric averaging of reference genes using algorithms like geNorm

    • Normalize cbiN expression against total RNA when appropriate

  • Statistical Tests for Differential Expression:

    • For comparing two conditions: paired or unpaired t-tests depending on experimental design

    • For multiple conditions: ANOVA followed by appropriate post-hoc tests

    • For non-normally distributed data: non-parametric alternatives (Mann-Whitney, Kruskal-Wallis)

  • Multiple Testing Correction:

    • Apply Benjamini-Hochberg procedure to control false discovery rate

    • Consider Bonferroni correction when stringent control of Type I errors is needed

    • Report both raw and adjusted p-values for transparency

  • Effect Size Calculation:

    • Calculate fold change to quantify expression differences

    • Determine confidence intervals for fold changes

    • Consider biological significance alongside statistical significance

When performing qRT-PCR experiments, ensure that PCR efficiency exceeds 80% for reliable quantification, as protocols used for other Nostoc genes have specified this threshold .

How can researchers integrate structural, functional, and evolutionary data to develop a comprehensive model of CbiN's role in cobalt homeostasis?

Developing a comprehensive model of CbiN's role in cobalt homeostasis requires integration of multiple data types:

  • Data Integration Framework:

    • Establish a curated database of all experimental results related to CbiN

    • Develop standardized metadata for experimental conditions

    • Use ontologies to facilitate cross-study comparisons

  • Multi-omics Integration:

    • Correlate transcriptomic data (cbiN expression) with metabolomic profiles

    • Link proteomics data on CbiN abundance with cobalt content measurements

    • Integrate with genomic context and evolutionary analyses

  • Network Analysis:

    • Construct protein-protein interaction networks centered on CbiN

    • Identify regulatory networks controlling cbiN expression

    • Map metabolic pathways dependent on cobalt availability

  • Systems Biology Modeling:

    • Develop mathematical models of cobalt transport kinetics

    • Simulate cellular responses to varying cobalt availability

    • Validate models with experimental data from diverse conditions

This integrated approach allows researchers to position CbiN within the broader context of cellular metal homeostasis, similar to how other Nostoc proteins have been studied in relation to their cellular functions and evolutionary origins .

How can CRISPR-Cas9 technology be applied to study CbiN function in Nostoc species?

CRISPR-Cas9 technology offers powerful approaches for studying CbiN function in Nostoc species:

  • Gene Knockout Strategies:

    • Design sgRNAs targeting multiple regions of the cbiN gene

    • Introduce CRISPR-Cas9 components via conjugation or electroporation

    • Screen transformants using PCR to confirm successful editing

    • Verify knockout at the protein level using Western blotting

  • CRISPRi for Conditional Regulation:

    • Use catalytically inactive Cas9 (dCas9) fused to repressor domains

    • Target the promoter region of cbiN for transcriptional repression

    • Create inducible CRISPRi systems for temporal control of gene expression

    • Monitor effects on cobalt transport and cellular metabolism

  • Precise Genomic Modifications:

    • Introduce specific mutations in metal-binding residues using homology-directed repair

    • Create reporter fusions at the native locus to monitor expression

    • Engineer affinity tags for in vivo interaction studies

  • Multiplexed Genetic Analysis:

    • Simultaneously target cbiN and related transport components

    • Create combinatorial knockout libraries to assess genetic interactions

    • Screen for synthetic phenotypes that reveal functional relationships

When applying CRISPR-Cas9 in Nostoc, consider using a codon-optimized Cas9 and testing multiple sgRNAs, as editing efficiency can vary significantly across target sites in cyanobacteria.

What potential biotechnological applications exist for engineered CbiN proteins in bioremediation or synthetic biology?

Engineered CbiN proteins offer several promising biotechnological applications:

  • Heavy Metal Bioremediation:

    • Engineer CbiN variants with enhanced binding capacity for toxic metals

    • Express optimized CbiN in robust environmental strains

    • Develop immobilized cell systems for continuous metal removal

    • Monitor remediation efficiency through metal content analysis

  • Biosensor Development:

    • Create CbiN-based cobalt biosensors by coupling to reporter systems

    • Optimize sensitivity and specificity through protein engineering

    • Develop field-deployable biosensors for environmental monitoring

    • Calibrate sensors against standard analytical methods

  • Metabolic Engineering for Vitamin B12 Production:

    • Enhance cobalt uptake through CbiN overexpression

    • Coordinate CbiN expression with cobalamin biosynthetic pathways

    • Engineer regulatory circuits for balanced cobalt homeostasis

    • Optimize production conditions based on cobalt transport dynamics

  • Synthetic Biology Applications:

    • Incorporate CbiN into artificial metal-responsive circuits

    • Develop cobalt-dependent gene expression systems

    • Create synthetic communities with programmed metal exchange

    • Design cellular diagnostics based on metal homeostasis

These applications build upon understanding of protein expression systems in Nostoc and related cyanobacteria, which have already demonstrated potential for recombinant protein production .

What are the most promising research directions for understanding CbiN function in the context of cyanobacterial metal homeostasis?

The most promising research directions for understanding CbiN function in cyanobacterial metal homeostasis include:

  • Integrated Multi-omics Approaches:

    • Combine transcriptomics, proteomics, and metallomics to develop comprehensive metal homeostasis models

    • Link CbiN expression patterns with global metabolic responses to varying metal availability

    • Identify regulatory networks controlling cobalt transport systems

  • Comparative Studies Across Diverse Environments:

    • Analyze CbiN sequence and functional variation in Nostoc strains from different habitats

    • Correlate CbiN properties with environmental cobalt availability

    • Investigate adaptations in extreme environments, similar to studies on ice-binding proteins

  • Structural Biology of Transport Complexes:

    • Determine the complete structure of CbiN within its native transport complex

    • Elucidate the molecular mechanism of cobalt selectivity and transport

    • Investigate conformational changes during the transport cycle

  • Systems Biology of Metal Homeostasis:

    • Develop mathematical models of cobalt transport and utilization

    • Simulate cellular responses to environmental fluctuations in metal availability

    • Predict emergent properties of metal homeostasis networks

These research directions promise to advance our understanding not only of CbiN but also of broader principles in bacterial metal transport systems and adaptation to varying environmental conditions.

How can researchers effectively compare and contrast findings from different methodological approaches to resolve contradictions in CbiN characterization?

When faced with contradictory results in CbiN characterization, researchers should adopt these strategies:

  • Systematic Comparison of Experimental Conditions:

    • Create standardized tables comparing key methodological parameters

    • Identify potential variables causing divergent results

    • Perform controlled experiments to test specific hypotheses about discrepancies

  • Meta-analysis Approaches:

    • Compile quantitative data from multiple studies

    • Apply statistical methods to identify patterns across studies

    • Weight findings based on methodological rigor and sample size

  • Collaborative Cross-validation:

    • Establish multi-laboratory validation studies

    • Share materials (plasmids, strains, antibodies) to eliminate technical variation

    • Develop standardized protocols for key assays

  • Integration of Complementary Methods:

    • Triangulate findings using fundamentally different approaches

    • Distinguish between in vitro and in vivo contexts for contradictory results

    • Consider time-resolved measurements to identify dynamic factors

Table 3: Framework for resolving contradictory findings in CbiN research

Contradiction TypeAssessment StrategyResolution ApproachValidation Method
Functional role discrepanciesCompare genetic backgroundsCreate isogenic strains for testingComplementation studies
Binding affinity differencesAnalyze buffer conditionsStandardize binding assaysITC under multiple conditions
Expression pattern variationsCompare growth conditionsPerform time-course studiesqRT-PCR with multiple reference genes
Subcellular localization conflictsEvaluate tagging strategiesUse multiple localization methodsFractionation plus immunoblotting
Interaction partner disagreementsReview detection methodsApply orthogonal interaction assaysReciprocal co-immunoprecipitation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.