Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 1 (petC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
petC1; all2453; Cytochrome b6-f complex iron-sulfur subunit 1; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1; ISP 1; RISP 1; Rieske iron-sulfur protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
petC1
Target Protein Sequence
MAQFSESVDVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDEL GNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVVESKEAITDYGINAVCTHLGCVVPWNAA ENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, this protein mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: ana:all2453

STRING: 103690.all2453

Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the iron-sulfur subunit play?

The cytochrome b6-f complex serves as a critical membrane protein complex in the electron transport chain of cyanobacteria like Nostoc sp. It functions as a plastoquinol-plastocyanin oxidoreductase, transferring electrons between photosystem II and photosystem I during photosynthesis . The iron-sulfur subunit (petC1) contains the Rieske [2Fe-2S] cluster that is essential for electron transfer within the complex.

In Nostoc sp. PCC 7120, the purified b6-f complex demonstrates high electron transport activity, with decyl-plastoquinol-plastocyanin oxidoreductase activity measured at approximately 277 ± 14 s–1·cyt f–1 . This activity depends on the proper incorporation and function of the iron-sulfur cluster within petC1.

How does the structure of the Nostoc sp. b6-f complex compare to that of other cyanobacteria?

The Nostoc sp. PCC 7120 b6-f complex has a stable dimeric structure containing eight subunits with characteristics similar to those found in Mastigocladus laminosus . The amino acid sequences of the large core subunits and four small peripheral subunits of Nostoc are 88% and 80% identical to those in the M. laminosus b6-f complex, respectively .

Unlike b6-f complexes isolated from unicellular cyanobacteria, which often lose stability during purification, the Nostoc complex maintains its dimeric structure and electron transport activity when appropriate isolation procedures are used . This inherent stability makes it an excellent candidate for structural and functional studies.

What are the optimal methods for purifying active cytochrome b6-f complex from Nostoc sp.?

Purification of active cytochrome b6-f complex from Nostoc requires specific methodological considerations to maintain stability and function:

  • Detergent selection is critical: Standard extraction with sodium cholate and octylglucoside results in rapid loss of oxidoreductase activity . Instead, the milder detergent undecyl-maltoside preserves complex activity.

  • Extraction protocol for Nostoc sp. PCC 7120:

    • Thylakoid membranes should be prepared with a cyt b6-f equivalent of approximately 2 mg/ml chlorophyll

    • Extraction with undecyl-maltoside under carefully controlled conditions

    • Purification should maintain a heme b:heme f ratio of 2:1 ± 0.07

  • Activity assessment: The purified complex should be evaluated for decyl-plastoquinol-plastocyanin oxidoreductase activity, with expected values around 277 ± 14 s–1·cyt f–1 .

What expression systems are most effective for producing recombinant petC1 with proper iron-sulfur cluster incorporation?

Expression of functional recombinant petC1 requires strategies to ensure proper folding and metal center incorporation:

  • Heterologous expression in E. coli:

    • Use specialized expression vectors with iron-sulfur cluster assembly operons

    • Growth under microaerobic conditions to prevent oxidative damage

    • Supplementation with iron and sulfur sources in the growth medium

    • Consider lower temperatures (16-25°C) during induction to promote proper folding

  • Homologous expression in cyanobacteria:

    • Expression in Nostoc sp. PCC 7120 offers advantages for proper post-translational modifications

    • The genome of Nostoc sp. PCC 7120 has been sequenced and the organism is amenable to genetic manipulation

  • Verification methods:

    • Spectroscopic analysis to confirm iron-sulfur cluster incorporation

    • EPR spectroscopy to verify the integrity of the [2Fe-2S] center

    • Activity assays to confirm functional electron transfer

What post-translational modifications occur in the Nostoc sp. iron-sulfur protein?

The Rieske iron-sulfur protein in Nostoc sp. undergoes N-terminal acetylation, a modification identified through mass spectrometry analysis . This post-translational modification is relatively uncommon in prokaryotic proteins but has been observed in the Nostoc b6-f complex.

N-terminal acetylation likely contributes to:

  • Enhanced protein stability within the membrane environment

  • Protection against N-terminal proteolysis

  • Proper protein-protein interactions within the complex

  • Optimal orientation within the membrane for electron transfer

Researchers studying recombinant petC1 should consider this modification when designing expression systems, as its absence might affect protein function and stability.

How do genomic differences in peptidase composition affect b6-f complex stability across cyanobacterial species?

Comparative genomic analysis reveals substantial differences in peptidase composition among cyanobacterial strains, which may directly impact b6-f complex stability:

StrainGenome size (Mbp)Total peptidasesUnique peptidases compared to Nostoc sp. PCC 7120
Nostoc sp. PCC 71207.21125-
A. variabilis7.0715720
S. elongatus2.710020
Synechocystis sp. PCC 68033.957811
T. elongatus2.59524

The lower number of unique peptidases in Nostoc sp. PCC 7120 compared to other cyanobacterial strains may contribute to the greater stability of its b6-f complex . Strains with more diverse peptidase profiles often yield unstable complexes during purification. This genomic characteristic provides a rationale for preferring Nostoc sp. for structural and functional studies of the cytochrome b6-f complex.

What techniques are most effective for studying electron transfer through recombinant petC1?

Several complementary techniques provide insights into electron transfer characteristics:

  • Spectroelectrochemical analysis:

    • Determination of midpoint potentials of the Rieske [2Fe-2S] center

    • Assessment of redox-dependent structural changes

  • Kinetic methods:

    • Stopped-flow spectroscopy with artificial electron donors/acceptors

    • Flash photolysis to measure electron transfer rates with high time resolution

  • EPR spectroscopy:

    • Characterization of the reduced [2Fe-2S] cluster

    • Investigation of distance relationships between redox centers

  • Site-directed mutagenesis:

    • Modification of key residues in the electron transfer pathway

    • Assessment of functional impacts through activity measurements

How can researchers address solubility and stability issues when working with recombinant petC1?

Recombinant petC1 often presents solubility challenges due to its membrane-associated nature and iron-sulfur cluster requirement:

  • Fusion protein strategies:

    • N-terminal fusion with solubility enhancers (MBP, SUMO, Trx)

    • Inclusion of removable tags that don't interfere with cluster assembly

  • Buffer optimization:

    • Inclusion of glycerol (10-20%) to enhance stability

    • Addition of mild detergents appropriate for maintaining structure

    • Use of reducing agents (DTT, β-mercaptoethanol) to protect the iron-sulfur cluster

  • Expression conditions:

    • Lower temperatures (16-20°C) during induction

    • Co-expression with chaperones to promote proper folding

    • Anaerobic or microaerobic conditions to prevent oxidative damage

  • Storage considerations:

    • Flash-freezing in liquid nitrogen with cryoprotectants

    • Storage under anaerobic conditions to maintain iron-sulfur cluster integrity

How do mutations in petC1 affect electron transport activity in the reconstituted b6-f complex?

Structure-function analysis through mutagenesis reveals critical aspects of petC1 function:

  • Cluster-coordinating residues:

    • Mutations of the cysteine residues that coordinate the [2Fe-2S] cluster typically abolish electron transfer activity

    • Conservative substitutions can alter redox potential without complete loss of function

  • Transmembrane anchor region:

    • Modifications affecting membrane association impact the stability of the entire complex

    • The flexibility of the linker region between transmembrane and iron-sulfur domains is essential for function

  • Interface residues:

    • Mutations at the interface with cytochrome b6 can disrupt electron transfer without affecting cluster assembly

    • Surface charge modifications can alter interaction kinetics with electron donors/acceptors

Functional reconstitution experiments should measure electron transport rates under standardized conditions, comparing wild-type and mutant proteins to establish structure-function relationships.

What are the challenges in achieving functional reconstitution of recombinant petC1 into membrane systems?

Functional reconstitution of recombinant petC1 presents several methodological challenges:

  • Incorporation strategies:

    • Liposome reconstitution requires careful selection of lipid composition

    • Nanodiscs provide a defined membrane environment but limit complex size

    • Proteoliposomes allow assessment of vectorial electron transfer but may have orientation issues

  • Stoichiometry considerations:

    • Proper ratios of all b6-f subunits are critical for function

    • Molar excess of petC1 may be required to ensure complete incorporation

  • Verification methods:

    • Freeze-fracture electron microscopy to visualize complex incorporation

    • Functional assays measuring electron transfer activity

    • Spectroscopic confirmation of redox center integrity

  • Activity optimization:

    • Inclusion of specific lipids known to associate with the native complex

    • Buffer optimization for maximal stability and function

    • Incorporation of native quinones as electron carriers

How does the petC1 gene in Nostoc sp. compare to homologs in other cyanobacteria?

Comparative genomic analysis reveals evolutionary relationships and functional adaptations:

  • Sequence conservation:

    • High conservation of cluster-coordinating residues across all cyanobacteria

    • The amino acid sequences of core subunits in Nostoc sp. PCC 7120 are 88% identical to those in Mastigocladus laminosus, indicating strong evolutionary conservation

  • Genome context:

    • Organization of the pet operon varies between filamentous and unicellular cyanobacteria

    • Co-transcription patterns may reflect adaptations to different environmental niches

  • Adaptation signatures:

    • Psychrophilic strains like Nostoc sp. CCCryo 231-06 may contain adaptive modifications for function at low temperatures

    • Comparative analysis of thermophilic versus mesophilic Nostoc strains reveals temperature-dependent adaptations

  • Multiple copies:

    • Some cyanobacteria contain multiple petC genes with specialized functions

    • Expression patterns of different paralogs may vary under different environmental conditions

What techniques are most effective for investigating protein-protein interactions within the b6-f complex?

Understanding interactions between petC1 and other subunits requires specialized approaches:

  • Cross-linking coupled with mass spectrometry:

    • Identification of specific residues at protein-protein interfaces

    • Mapping of dynamic interactions during electron transfer

  • Hydrogen-deuterium exchange mass spectrometry:

    • Detection of protected regions indicating interaction surfaces

    • Identification of conformational changes upon complex formation

  • Cryo-electron microscopy:

    • Visualization of the complete complex at high resolution

    • Identification of conformational states during electron transfer

  • Co-purification assays:

    • Pull-down experiments to identify stable interactions

    • Blue-native PAGE to preserve native complex interactions

  • Förster resonance energy transfer (FRET):

    • Real-time analysis of protein association in reconstituted systems

    • Detection of conformational changes during electron transfer

How can recombinant petC1 be utilized in artificial photosynthetic systems?

Recombinant petC1 offers potential applications in synthetic biology and bioenergetics:

  • Biohybrid solar cells:

    • Integration of petC1 as an electron transfer component

    • Coupling with photosensitizers for light-driven electron transport

  • Biosensors:

    • Exploitation of redox-dependent conformational changes for detecting analytes

    • Development of electrochemical biosensors based on electron transfer properties

  • Biocatalysis:

    • Coupling electron transfer from petC1 to enzymatic reactions

    • Design of artificial redox cascades for bioproduction

  • Methodological considerations:

    • Immobilization strategies to maintain protein orientation and function

    • Surface chemistry modifications for interfacing with electrodes

    • Protein engineering to enhance stability under non-native conditions

What approaches can be used to enhance the stability of recombinant petC1 for biotechnological applications?

Enhancing stability of recombinant petC1 requires multifaceted approaches:

  • Protein engineering strategies:

    • Introduction of disulfide bonds to enhance structural stability

    • Surface charge optimization to reduce aggregation

    • Thermostabilizing mutations based on comparative genomics

  • Formulation development:

    • Identification of optimal buffer compositions

    • Addition of stabilizing excipients (trehalose, sucrose)

    • Incorporation into protective matrices or scaffolds

  • Post-translational modifications:

    • Mimicking the N-terminal acetylation observed in native Nostoc petC1

    • Engineering glycosylation sites for enhanced solubility

  • Environmental considerations:

    • Encapsulation in protective matrices

    • Oxygen-scavenging systems to prevent oxidative damage

    • Temperature-responsive polymers for thermal protection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.