Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 2 (petC2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nostoc sp. Cytochrome b6-f Complex Iron-Sulfur Subunit 2 (petC2)

Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 2 (petC2) is a protein component of the cytochrome b6-f complex found in the cyanobacterium Nostoc sp. . The cytochrome b6-f complex is an essential part of the photosynthetic electron transport chain in cyanobacteria and plant chloroplasts . PetC2, along with other subunits, facilitates electron transfer between plastoquinol and plastocyanin, which is crucial for generating the proton gradient that drives ATP synthesis .

PetC Isoforms and Their Roles

Cyanobacteria like Synechocystis PCC 6803 can possess multiple Rieske isoforms, such as PetC1, PetC2, and PetC3 . While PetC1 and PetC2 are alternative subunits of the cytochrome b6-f complex, PetC3 appears to have a distinct function related to cell envelope homeostasis .

  • PetC1 and PetC2: These isoforms can partially substitute for each other in the cytochrome b6-f complex, although PetC1 is typically the predominant isoform . Double deletion experiments in Synechocystis have shown that PetC1 and PetC2 cannot be deleted in combination without causing significant functional damage, highlighting their importance .

  • PetC3: This isoform cannot functionally replace PetC1 or PetC2 and is localized exclusively within the plasma membrane . Deletion of petC3 primarily affects cell envelope proteins and nutrient transport systems, indicating a role in maintaining cell envelope integrity rather than direct involvement in photosynthetic electron transport .

4.1. Crystallographic Analysis

Crystallographic studies of the cytochrome b6-f complex from Nostoc sp. PCC 7120 have yielded structures with a resolution of 3.0 Å, similar to those obtained for M. laminosus . Key findings include:

  • Heme bP Conformation: A dominant conformation of heme bP is rotated 180° relative to its orientation in M. laminosus .

  • N-terminal Acetylation: The Rieske iron-sulfur protein (PetC) is acetylated at the N-terminus, a unique post-translational modification .

4.2. Mass Spectrometry

Electrospray-ionization mass spectrometry has confirmed the eight-subunit composition of the purified cytochrome b6-f complex from Nostoc sp. . The analysis revealed that the N-terminus of the Rieske ISP is partly acetylated, with a mass increase of 42 Da compared to the predicted mass .

Table 1: Subunit Composition and Mass Spectrometry Analysis of Nostoc sp. Cytochrome b6-f Complex

SubunitMolecular Mass (Da)Modification
Rieske ISP (PetC)19,064.2Met-1 removed
Acetylated Rieske ISP19,106.6N-terminal acetyl

4.3. Functional Characterization

The cytochrome b6-f complex from Nostoc sp. exhibits significant electron transport activity, comparable to that of M. laminosus . This activity is essential for photosynthetic electron transport and the generation of a proton gradient .

Implications and Significance

The characterization of Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 2 (petC2) provides insights into the structure, function, and regulation of the cytochrome b6-f complex in cyanobacteria . Understanding the roles of different PetC isoforms and their post-translational modifications is crucial for comprehending the photosynthetic electron transport chain and its regulation . Such knowledge can be applied in biotechnological applications, such as improving photosynthetic efficiency in engineered cyanobacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petC2; all4511; Cytochrome b6-f complex iron-sulfur subunit 2; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2; ISP 2; RISP 2; Rieske iron-sulfur protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
petC2
Target Protein Sequence
MDDTLNQANPSMSRRQLLNFFTGAIVATTASAAIYPATKFFMPPAESTDAEGGILAQDKI GHPIPASQILAQASGTRALIAGLAGEPTYLTVREDGTLDPMGIVNNCTHLGCTFPWNPVD QQFQCPCHGSRYDAQGSVERGPANRPLKLVQVQVKDDYIWISPWQETDPRTGEKPWWV
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: ana:all4511

STRING: 103690.all4511

Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.