Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit 3 (petC3)

Shipped with Ice Packs
In Stock

Description

Physiological Role and Functional Insights

petC3 is part of the cytochrome b6-f complex, which bridges PSII and PSI. While its primary role overlaps with other Rieske subunits (e.g., PetC1, PetC2), studies in Synechocystis PCC 6803 reveal distinct functional divergence:

SubunitKey Functional InsightsSource
PetC1Dominant Rieske isoform; cannot be deleted with PetC2.
PetC2Partially compensates for PetC1; cannot be deleted with PetC1.
PetC3Unique function; interacts with donors of lower redox potential than plastoquinone.

In Nostoc sp., petC3 likely participates in:

  • Cyclic Electron Flow: Stabilizing ATP production under stress.

  • Redox Homeostasis: Modulating electron transfer efficiency.

Recombinant Production and Applications

petC3 is heterologously expressed in E. coli using optimized protocols:

ParameterDetailsSource
Expression SystemIn vitro E. coli system
PurificationHis-tag affinity chromatography (full-length variants)
ApplicationsSDS-PAGE analysis, ELISA assays, structural studies

Comparative Analysis of Rieske Subunits

While petC3 shares structural homology with other Rieske subunits, its functional niche diverges:

FeaturePetC1/PetC2PetC3Source
Redox PotentialOptimized for plastoquinone (higher E°)Interacts with lower E° donors
EssentialityRequired in combination (PetC1+PetC2)Non-essential (can be deleted alone)
Evolutionary ConservationWidespread in cyanobacteriaLimited to specific lineages

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petC3; petC4; all1512; Cytochrome b6-f complex iron-sulfur subunit 3; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 3; ISP 3; RISP 3; Rieske iron-sulfur protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
petC3
Target Protein Sequence
MDNSIPIESPSLSRRQLLNFITGATVAVTAGAALYPAGKFLIAPAEKTGAGGAILAKDIL GKQIPASQILAEPPQTRALVAGLAGEPTYLIVKEDHTLDRIGLVDNCTHLGCTFPWNPLD QQFQCPCHGSRYAPDGSVVRGPAPLPLKIVQVAVIDNSILISPWTETDPRTGKKPWWV
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: ana:all1512

STRING: 103690.all1512

Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the iron-sulfur protein play?

The cytochrome b6-f complex is an essential component in both photosynthetic and respiratory electron transport in cyanobacteria. It acts as a membrane-bound protein complex that facilitates electron transfer between photosystems while contributing to the generation of proton gradient for ATP synthesis. The Rieske iron-sulfur protein (ISP) serves as one of the essential subunits of this complex, playing a crucial role in electron transfer reactions through its iron-sulfur cluster.

How many petC genes are present in cyanobacteria and what makes them different?

Unlike other subunits of the cytochrome b6-f complex that are encoded by single genes, many cyanobacterial genomes contain multiple genes encoding Rieske iron-sulfur proteins. In Synechocystis sp. PCC 6803, which serves as a model organism for understanding cyanobacterial physiology, three distinct petC genes (petC1, petC2, petC3) encode different forms of Rieske ISPs. Each of these proteins appears to serve different physiological functions within the electron transport chain, with PetC1 being the predominant form under standard growth conditions.

What is known about the independent function of petC3?

Gene expression data and deletion studies suggest that PetC3 has a function independent of the standard cytochrome b6-f complex. Unlike PetC1 and PetC2, which can functionally substitute for each other to some extent, PetC3 cannot replace either of these proteins in their role within the complex. Research indicates that PetC3 may interact with a special electron donor having a lower redox potential than plastoquinone, suggesting a specialized role in alternative electron transport pathways.

What are the most effective methods for generating recombinant petC3 protein from Nostoc sp.?

To generate recombinant petC3 protein from Nostoc sp., researchers typically employ a molecular cloning approach involving:

  • Gene amplification: PCR amplification of the petC3 gene from Nostoc sp. genomic DNA using specific primers that include appropriate restriction sites

  • Vector construction: Cloning the amplified gene into an expression vector with a suitable promoter and tag system (commonly His-tag for easier purification)

  • Expression system: Transformation into an E. coli expression system optimized for membrane proteins or iron-sulfur proteins

  • Protein expression: Induction under anaerobic or microaerobic conditions to facilitate proper iron-sulfur cluster assembly

  • Purification: Using affinity chromatography followed by size exclusion chromatography

For optimal functionality, expression should be conducted at lower temperatures (16-20°C) and may require co-expression with iron-sulfur cluster assembly proteins to ensure proper folding and incorporation of the cluster.

How can researchers effectively study the electron transfer properties of recombinant petC3?

To investigate the electron transfer properties of recombinant petC3, researchers can employ several complementary approaches:

  • Laser flash absorption spectroscopy: This technique allows measurement of the kinetics of electron transfer between petC3 and potential electron transfer partners under controlled conditions. The method involves a rapid laser flash to initiate the reaction followed by monitoring absorbance changes at specific wavelengths corresponding to the redox states of the proteins.

  • Redox potential determination: Techniques such as potentiometric titrations coupled with spectroscopic measurements can help determine the midpoint potential of the iron-sulfur cluster in petC3, providing insights into its position in the electron transfer chain.

  • In vitro reconstitution: Incorporating purified recombinant petC3 into liposomes with putative electron transfer partners to measure electron transfer rates and substrate specificity.

  • Site-directed mutagenesis: Systematic modification of key residues followed by kinetic analysis to identify amino acids critical for electron transfer efficiency and specificity.

How does petC3 structurally and functionally differ from petC1 and petC2?

The three petC isoforms in cyanobacteria exhibit significant structural and functional differences as summarized in the following table:

FeaturepetC1petC2petC3
Primary roleMajor Rieske ISP in cytochrome b6-f complexAlternative Rieske ISP under specific conditionsIndependent function outside standard complex
Expression patternConstitutive expression under standard growth conditionsElevated expression during dark anaerobiosisFunction-specific expression pattern
Functional redundancyCannot be deleted with petC2Cannot be deleted with petC1Can be deleted with either petC1 or petC2
Ability to substituteStandard componentCan partially replace petC1Cannot functionally replace petC1 or petC2
Proposed electron donorPlastoquinonePlastoquinoneSpecial donor with lower redox potential than plastoquinone
Catalytic efficiencyHighest efficiency in electron transferLower efficiency compared to petC1Specialized function with different kinetics

These differences indicate distinct evolutionary adaptations that may allow the cyanobacterium to optimize electron transfer under varying environmental conditions.

What experimental evidence demonstrates the functional differences between petC genes?

RT-qPCR expression analysis also shows distinctive expression patterns, with petC2 showing elevated expression during dark anaerobiosis in wild-type cells and significantly increased expression in ΔPetC1 mutants, consistent with its role as an alternative ISP under specific conditions.

How might the redox properties of petC3 influence its potential specialized functions?

The redox properties of petC3 likely play a crucial role in determining its specialized function within cyanobacterial metabolism. Research suggests that petC3 may interact with an electron donor having a lower redox potential than plastoquinone, which is the standard donor for the cytochrome b6-f complex.

This distinct redox characteristic could enable petC3 to:

  • Participate in alternative electron transport pathways that become active under specific environmental conditions or stresses

  • Function in redox sensing or signaling mechanisms that help the cell respond to changing environmental conditions

  • Interact with specific electron transfer partners that operate at different redox potentials compared to the standard photosynthetic electron transport chain

  • Contribute to cyclic electron flow around photosystem I under conditions where linear electron transport is limited

Understanding the precise redox properties of petC3 through techniques such as protein film voltammetry and potentiometric titrations coupled with EPR spectroscopy would provide valuable insights into its physiological role.

What are the main technical challenges in studying recombinant petC3?

Several technical challenges complicate the study of recombinant petC3:

  • Expression and purification: As an iron-sulfur protein, petC3 requires proper incorporation of the iron-sulfur cluster during heterologous expression. This often necessitates specialized expression systems, anaerobic conditions, and co-expression with iron-sulfur cluster assembly proteins.

  • Structural determination: The transient nature of electron transfer complexes makes structural studies challenging. While techniques like NMR relaxation spectroscopy have been applied to other components of the electron transport chain in Nostoc, obtaining detailed structural information for petC3 complexes remains difficult.

  • Identifying physiological partners: The specialized function of petC3 suggests it may interact with electron transfer partners that are only active under specific conditions, making their identification challenging.

  • Functional redundancy: The ability of cyanobacteria to adapt to the deletion of individual petC genes complicates functional studies, requiring sophisticated approaches to reveal the specific role of petC3.

  • Environmental relevance: Determining the environmental conditions under which petC3 becomes physiologically important requires systematic testing of various growth conditions and stresses.

What emerging research directions may elucidate the role of petC3 in cyanobacterial metabolism?

Several promising research directions could help uncover the specialized role of petC3:

  • Systems biology approaches: Integration of transcriptomics, proteomics, and metabolomics data across different environmental conditions could reveal patterns of petC3 expression and activity. High-precision, wide dynamic range proteomics methods established for Synechocystis could be adapted for studying Nostoc sp.

  • Redox proteomics: Quantitative site-specific proteomics profiling of protein thiols could identify light-dependent redox modifications that might regulate petC3 function or its interaction partners.

  • Synthetic biology applications: Creating chimeric proteins or directed evolution of petC3 could provide insights into structure-function relationships and potentially reveal its natural electron transfer partners.

  • Cryo-electron microscopy: This technique could potentially capture petC3 in complex with its interaction partners, providing structural insights that have been challenging to obtain through other methods.

  • Mathematical modeling: From genome-scale modeling to multi-scale kinetic models of carbon metabolism, computational approaches could help predict and test the role of petC3 in alternative electron flow pathways.

  • Comparative genomics: Analysis of petC3 conservation and variation across diverse cyanobacterial species could provide evolutionary insights into its specialized function.

What consensus exists regarding the physiological role of petC3?

Based on the available evidence, researchers generally agree that petC3 serves a function distinct from the standard roles of petC1 and petC2 within the cytochrome b6-f complex. Double deletion studies clearly demonstrate that petC3 cannot functionally replace the other Rieske proteins in their role in the main photosynthetic and respiratory electron transport chains.

The current consensus suggests petC3 may:

  • Participate in alternative electron transport pathways

  • Become active under specific environmental or stress conditions

  • Interact with electron donors having different redox properties than those in the standard pathways

  • Potentially serve in a regulatory or sensing capacity rather than primarily in energy transduction

What methodological approaches are recommended for researchers new to petC3 studies?

For researchers beginning work on petC3, the following methodological approaches are recommended:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.