Recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nostoc sp. Cytochrome b6-f Complex Iron-Sulfur Subunit (petC)

The recombinant Nostoc sp. cytochrome b6-f complex iron-sulfur subunit (petC) is a component of the cytochrome b6f complex found in the cyanobacterium Nostoc sp. PCC 7120 . This complex is crucial for photosynthetic electron transport, mediating electron transfer between Photosystem II and Photosystem I . The petC subunit, also known as the Rieske iron-sulfur protein, is an essential part of this complex .

Structure and Composition

The cytochrome b6f complex is a dimer, with each monomer consisting of eight subunits . These subunits include:

  • Cytochrome f (32 kDa)

  • Cytochrome b6 (25 kDa)

  • Rieske iron-sulfur protein (19 kDa)

  • Subunit IV (17 kDa)

  • Four small subunits: PetG, PetL, PetM, and PetN (3-4 kDa)

The complex has a total molecular weight of 217 kDa . The core structure is similar to the cytochrome bc1 core, with cytochrome b6 and subunit IV homologous to cytochrome b, and the Rieske iron-sulfur proteins of the two complexes sharing homology .

The Nostoc sp. petC subunit has a high degree of similarity to that of Mastigocladus laminosus, with amino acid sequences of the large core subunits and four small peripheral subunits being 88% and 80% identical, respectively .

Prosthetic Groups

The cytochrome b6f complex contains seven prosthetic groups:

  • c-type heme of cytochrome c1 and f

  • Two b-type hemes (bp and bn)

  • [2Fe-2S] cluster of the Rieske protein

  • Chlorophyll a

  • β-carotene

  • Heme cn (heme x)

Biological Function

The cytochrome b6f complex plays a vital role in photosynthesis by mediating electron and energy transfer between Photosystem II and Photosystem I . It also transfers protons from the chloroplast stroma across the thylakoid membrane into the lumen, creating a proton gradient that drives ATP synthesis in chloroplasts .

Additionally, the cytochrome b6f complex is central to cyclic photophosphorylation, which is crucial when NADP+ is unavailable to accept electrons from reduced ferredoxin . This cycle helps maintain the correct ATP/NADPH production ratio for carbon fixation and is essential for photosynthesis .

Reaction Mechanism

The cytochrome b6f complex facilitates both non-cyclic and cyclic electron transfer between plastoquinol (QH2) and plastocyanin (Pc) :

Non-cyclic electron transfer:

$$ H_2O \rightarrow Photosystem II \rightarrow QH_2 \rightarrow Cyt\ b_6f \rightarrow Pc \rightarrow Photosystem I \rightarrow NADPH $$

Cyclic electron transfer:

$$ QH_2 \rightarrow Cyt\ b_6f \rightarrow Pc \rightarrow Photosystem I \rightarrow Q $$

The complex catalyzes electron transfer from plastoquinol to plastocyanin, pumping two protons from the stroma into the thylakoid lumen :

$$ QH_2 + 2Pc(Cu^{2+}) + 2H^+(stroma) \rightarrow Q + 2Pc(Cu^+) + 4H^+(lumen) $$

This reaction occurs via the Q cycle, similar to Complex III . Plastoquinol transfers its two electrons to high- and low-potential electron transport chains through electron bifurcation. The complex contains up to three plastoquinone molecules that form an electron transfer network responsible for the Q cycle's operation and its redox-sensing and catalytic functions in photosynthesis .

Recombinant Production and Characteristics

The recombinant Nostoc sp. cytochrome b6-f complex iron-sulfur subunit (petC) is produced in E. coli as a His-tagged protein . The purified b6f complex from Nostoc sp. PCC 7120 exhibits a stable dimeric structure, eight subunits with masses similar to those of M. laminosus, and comparable electron transport activity .

Post-Translational Modification

A unique feature of the Nostoc complex is the acetylation of the Rieske iron-sulfur protein (PetC) at the N terminus . This post-translational modification is unprecedented in cyanobacterial membrane and electron transport proteins, as well as in polypeptides of cytochrome bc complexes from any source . Mass spectrometry analysis has confirmed the N-terminal acetylation of the Rieske ISP .

Table 1: Subunit Composition of Purified Nostoc sp. Cytochrome b6-f Complex

SubunitMolecular Mass (Da)
Rieske ISP (petC)19,106.6
Cytochrome fNot specified
Cytochrome b6Not specified
Subunit IVNot specified
Small Subunits (PetG, PetL, PetM, PetN)Not specified

Crystallographic Analysis

  1. A dominant conformation of heme bp that is rotated 180° about the α- and γ-meso carbon axis relative to the orientation in the M. laminosus complex .

  2. Acetylation of the Rieske iron-sulfur protein (PetC) at the N terminus .

Research Applications

The recombinant Nostoc sp. cytochrome b6-f complex iron-sulfur subunit (petC) is valuable for various research applications, including:

  • Studying the structure and function of the cytochrome b6f complex

  • Investigating electron transport mechanisms in photosynthesis

  • Analyzing the role of post-translational modifications in protein function

  • Developing biotechnological applications related to photosynthesis and energy production

Suppliers

Several suppliers offer recombinant Nostoc sp. Cytochrome b6-f complex iron-sulfur subunit (petC) for research purposes :

  • CUSABIO TECHNOLOGY LLC

  • MyBioSource

  • Creative BioMart

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Desmonostoc sp. (strain PCC 7906) (Nostoc sp. (strain PCC 7906))
Target Names
petC
Target Protein Sequence
MAQFSESADVPDMGRRQFMNLLTFGTVTGVALGALYPVVKYFIPPASGGAGGGTTAKDEL GNDVSLSKFLENRNAGDRALVQGLKGDPTYIVVENKQAIKDYGINAICTHLGCVVPWNVA ENKFKCPCHGSQYDETGKVVRGPAPLSLALAHANTVDDKIILSPWTETDFRTGDAPWWA
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the Rieske iron-sulfur protein (petC) in Nostoc sp. and what is its function?

The Rieske iron-sulfur protein (petC) is one of the eight subunits of the cytochrome b6-f complex in Nostoc sp. PCC 7120, a filamentous cyanobacterium. This protein contains a [2Fe-2S] cluster and plays a crucial role in electron transfer within the photosynthetic electron transport chain. As part of the cytochrome b6-f complex, petC participates in the transfer of electrons from plastoquinol to plastocyanin, contributing to the generation of a proton gradient across the thylakoid membrane that drives ATP synthesis .

The petC subunit in Nostoc exhibits high sequence identity (approximately 80%) to the corresponding subunit in Mastigocladus laminosus, another filamentous cyanobacterium. This high degree of conservation reflects the essential nature of this protein in photosynthetic electron transport .

What unique structural features characterize the petC subunit in Nostoc sp.?

The most notable unique feature of the petC subunit in Nostoc sp. PCC 7120 is its N-terminal acetylation, a post-translational modification that had not been previously documented in cyanobacterial membrane and electron transport proteins or in polypeptides of cytochrome bc complexes from any source prior to its discovery . This acetylation may contribute to the protein's stability and functionality within the complex.

The three-dimensional structure of the petC subunit, as part of the cytochrome b6-f complex from Nostoc sp. PCC 7120, has been determined by X-ray crystallography to a resolution of 3.0Å (PDB id: 2ZT9). The root-mean-square deviation (r.m.s.d.) between the Rieske [2Fe-2S] cluster position in Nostoc and M. laminosus is only 0.51 Å, indicating high structural conservation of this critical component .

How stable is the Nostoc cytochrome b6-f complex compared to those from other cyanobacteria?

The cytochrome b6-f complex from Nostoc sp. PCC 7120 demonstrates remarkable stability compared to complexes isolated from unicellular cyanobacteria. While attempts to purify stable cytochrome b6-f complexes from several unicellular cyanobacteria (such as Thermosynechococcus elongatus, Synechococcus elongatus, and Synechocystis sp. PCC 6803) have resulted in unstable complexes, the complex from Nostoc maintains a stable dimeric structure with significant electron transport activity .

This stability difference might be attributed to variations in endogenous peptidase activity. Comparative genomic analysis revealed differences in peptidase composition among cyanobacterial strains, as shown in the following table:

StrainGenome size (Mbp)Total, known, or putative peptidasesUnique peptidases compared to Nostoc sp. PCC 7120
Nostoc sp. PCC 71207.21125-
A. variabilis7.0715720
S. elongatus2.710020
Synechocystis sp. PCC 68033.957811
T. elongatus2.59524

The distinct peptidase profile of Nostoc may contribute to the preservation of the dimeric structure and function of its cytochrome b6-f complex .

What are the optimal conditions for expressing and purifying recombinant petC from Nostoc sp.?

Expression and purification of recombinant petC from Nostoc require careful consideration of detergent selection and extraction methods to maintain the protein's native conformation and activity. Research has demonstrated that using milder maltoside detergents, specifically undecyl-maltoside, for extraction yields better results than harsher detergent mixtures like sodium cholate and octylglucoside .

When extracting the cytochrome b6-f complex containing petC from Nostoc thylakoid membranes, researchers observed rapid loss of oxidoreductase activity when using the same procedure that worked for M. laminosus. This suggests that extraction with a mixture of ionic and glycoside detergents may cause lipid depletion and/or dissociation of integral components from the complex .

For optimal purification outcomes, researchers should maintain a cyt b6-f equivalent of approximately 2 mg/ml chlorophyll in thylakoid membrane preparations. Under these conditions, the purified complex maintains its dimeric structure and exhibits decyl-plastoquinol-plastocyanin oxidoreductase activity of 277 ± 14 s–1·cyt f–1 .

How does the N-terminal acetylation of petC impact protein function and stability?

The N-terminal acetylation of the Rieske iron-sulfur protein (petC) in Nostoc represents an unusual post-translational modification in cyanobacterial proteins. While the precise functional implications of this modification remain to be fully elucidated, research suggests several potential impacts:

  • Increased protein stability by protecting the N-terminus from degradation by aminopeptidases

  • Modified protein-protein interactions within the cytochrome b6-f complex

  • Altered redox properties of the [2Fe-2S] cluster

  • Enhanced anchoring of the protein in the membrane environment

This post-translational modification is significant because N-terminal acetylation is common in proteins of eukaryotes and halophilic archaea but had not been previously documented in cyanobacterial membrane and electron transport proteins . Investigating the enzymatic machinery responsible for this acetylation and its specific effects on electron transfer kinetics represents an important avenue for future research.

What structural and functional differences exist between the [2Fe-2S] cluster of petC from Nostoc and other cyanobacteria?

The [2Fe-2S] cluster in the Rieske iron-sulfur protein (petC) of Nostoc shows remarkable structural conservation compared to other cyanobacteria, particularly M. laminosus. The root-mean-square deviation between the [2Fe-2S] cluster positions in these two species is only 0.51 Å, indicating high structural similarity .

This raises important questions about how the [2Fe-2S] cluster in petC maintains its structural integrity and position despite significant conformational changes in nearby prosthetic groups, and whether subtle electronic or dynamic differences might exist that aren't captured by static crystallographic analysis.

What crystallization conditions are optimal for structural studies of the Nostoc cytochrome b6-f complex containing petC?

Successful crystallization of the Nostoc sp. PCC 7120 cytochrome b6-f complex was achieved under conditions that yielded crystals diffracting to a resolution of 3.0 Å. The crystals belong to the P65 space group with unit-cell parameters a = b = 159.2 Å, c = 365.9 Å, which are very similar to those obtained for the M. laminosus complex .

For researchers attempting crystallization, several critical factors should be considered:

  • Purity and homogeneity of the protein complex

  • Detergent selection and concentration

  • Lipid content preservation during extraction

  • Buffer composition and pH

  • Precipitant selection and concentration gradient

  • Temperature and time for crystal growth

The similar unit-cell parameters between Nostoc and M. laminosus crystals suggest that crystallization conditions successful for one might be adaptable for the other, providing a useful starting point for optimization .

How can researchers accurately assess the electron transport activity of purified cytochrome b6-f complex containing petC?

Accurate assessment of electron transport activity in the purified cytochrome b6-f complex containing petC requires precise spectrophotometric measurements and appropriate substrates. The standard assay measures decyl-plastoquinol-plastocyanin oxidoreductase activity, which for the Nostoc complex has been reported as 277 ± 14 s–1·cyt f–1 .

The procedure includes:

  • Determination of cytochrome f concentration by redox difference spectrophotometry using established extinction coefficients

  • Preparation of reduced decyl-plastoquinol as the electron donor

  • Isolation or recombinant production of plastocyanin as the electron acceptor

  • Monitoring the oxidation of decyl-plastoquinol or the reduction of plastocyanin spectrophotometrically

  • Calculation of activity rates normalized to cytochrome f content

Researchers should be aware that activity measurements are sensitive to detergent type and concentration, lipid content, temperature, and buffer composition. The loss of activity observed when using harsher detergents highlights the importance of maintaining a native-like environment during extraction and purification .

What approaches can be used to study the post-translational modifications of petC in Nostoc?

The discovery of N-terminal acetylation in the petC subunit from Nostoc highlights the importance of investigating post-translational modifications in this protein. Several methodological approaches can be employed:

  • Mass Spectrometry: Tandem mass spectrometry (MS/MS) provides the most direct evidence for acetylation and other modifications. For petC, careful sample preparation is crucial, including appropriate protease digestion to generate peptides containing the N-terminus.

  • Protein Sequencing: Edman degradation can confirm N-terminal modifications, though it may be blocked by acetylation.

  • Immunological Methods: Antibodies specific to acetylated lysine residues can be used in western blotting, though this may not detect N-terminal acetylation.

  • Functional Assays: Comparing the properties of native petC with recombinant versions lacking specific modifications can reveal their functional significance.

  • In silico Analysis: Computational tools can predict potential modification sites and the enzymes responsible, guiding experimental investigations.

For comprehensive characterization, researchers should combine these approaches, particularly focusing on comparative analysis between petC from Nostoc and other cyanobacteria to identify unique modifications and their physiological implications .

How does the petC sequence and structure from Nostoc compare to homologous proteins in other photosynthetic organisms?

The petC subunit from Nostoc sp. PCC 7120 shows significant sequence similarity to homologous proteins in other photosynthetic organisms, but with notable differences that may reflect evolutionary adaptations to different environmental niches.

  • The presence of N-terminal acetylation not documented in other cyanobacterial cytochrome b6-f complexes

  • Association with a cytochrome b6-f complex that maintains a stable dimeric structure, unlike complexes from several unicellular cyanobacteria

  • Proximity to a uniquely oriented heme bp within the complex

These differences may reflect adaptations that contribute to the robust nature of electron transport in Nostoc and potentially relate to its ecological success in diverse environments .

What can be learned from comparing the ice-binding properties of proteins from Nostoc with the structure of petC?

Recent research has identified ice-binding proteins (IBPs) associated with Antarctic cyanobacterium Nostoc sp. HG1 . While the search results don't explicitly connect these ice-binding properties to the petC subunit, this raises interesting questions about potential structural adaptations in membrane proteins, including components of the photosynthetic electron transport chain, in cold-adapted Nostoc species.

Comparative structural analysis between petC from standard and cold-adapted Nostoc strains might reveal:

  • Amino acid substitutions that modify protein flexibility at low temperatures

  • Adaptations that maintain the redox properties of the [2Fe-2S] cluster across a broader temperature range

  • Potential interactions with ice-binding proteins that could protect membrane integrity in freezing conditions

  • Modifications to protein-protein interactions within the cytochrome b6-f complex that preserve electron transport function at low temperatures

This comparative approach could provide insights into the evolution of cold adaptation strategies in photosynthetic organisms and potentially inspire biomimetic approaches for engineering cold-tolerant photosynthetic systems .

What are the implications of studying petC structure-function relationships for improving photosynthetic efficiency?

Understanding the structure-function relationships of petC in Nostoc has significant implications for efforts to enhance photosynthetic efficiency in both natural and artificial systems. The cytochrome b6-f complex represents a rate-limiting step in photosynthetic electron transport, making it a key target for optimization.

Future research could explore:

  • Engineering petC variants with modified redox potentials to alter electron transfer kinetics

  • Investigating how the unique N-terminal acetylation in Nostoc petC affects protein turnover and stability

  • Developing synthetic biology approaches to introduce Nostoc-specific features into crop plants

  • Creating biomimetic electron transport systems based on the robust properties of the Nostoc complex

The stable dimeric structure of the Nostoc cytochrome b6-f complex makes it an excellent model system for these investigations, potentially leading to innovations in both agricultural biotechnology and artificial photosynthesis .

How might recent advances in cryo-electron microscopy change our understanding of petC dynamics?

While the crystal structure of the Nostoc cytochrome b6-f complex has been determined at 3.0 Å resolution , advances in cryo-electron microscopy (cryo-EM) offer opportunities to study the dynamic aspects of petC function that may not be captured in crystal structures.

Cryo-EM could potentially reveal:

  • Conformational changes in petC during electron transfer

  • The dynamic interaction between petC and other components of the complex

  • Structural variations that might exist in solution but are constrained in crystal lattices

  • The native lipid environment surrounding the complex and its influence on function

Additionally, time-resolved cryo-EM approaches could potentially capture the protein in different states during the electron transfer process, providing unprecedented insights into the mechanism of electron transport through the [2Fe-2S] cluster of petC .

What potential biotechnological applications could emerge from studying the unique properties of Nostoc petC?

The unique properties of petC from Nostoc, including its N-terminal acetylation and association with a stable cytochrome b6-f complex, suggest several potential biotechnological applications:

  • Development of robust electron transport modules for synthetic biology applications

  • Design of enhanced biocatalysts for solar energy conversion

  • Creation of biosensors utilizing the redox properties of the [2Fe-2S] cluster

  • Engineering of stress-resistant photosynthetic systems for bioremediation

The fact that Nostoc species have also been traditionally used as food sources in various cultures adds another dimension to potential applications, as engineered Nostoc strains could potentially serve as nutritionally enhanced food sources with improved photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.