Recombinant Nostoc sp. Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nostoc sp. Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Nostoc sp. Cytochrome b6-f complex subunit 4 (petD) is a protein derived from the cyanobacterium Nostoc, which plays a crucial role in the electron transport chain of photosynthesis. This protein is part of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating both linear and cyclic electron flow . The recombinant form of this protein is produced through genetic engineering techniques, often expressed in hosts like E. coli or yeast, to facilitate research and applications in biotechnology and biochemistry.

Structure and Function

The cytochrome b6-f complex is essential for photosynthesis, acting as a bridge between the two photosystems. Subunit 4 (petD) is a small polypeptide that contributes to the structural integrity and function of the complex. The recombinant version of this subunit is typically produced with tags (e.g., His-tag) to facilitate purification and identification.

2.2. Expression Systems

Recombinant petD proteins can be expressed in various systems, including E. coli, yeast, and even mammalian cells, depending on the desired application and purity requirements .

Production and Purification

The production of recombinant Nostoc sp. Cytochrome b6-f complex subunit 4 (petD) involves several steps:

  1. Cloning: The gene encoding petD is cloned into an expression vector.

  2. Expression: The vector is introduced into a host organism (e.g., E. coli), where the protein is expressed.

  3. Purification: The protein is purified using affinity chromatography, often facilitated by a His-tag.

Applications and Research Findings

Recombinant Nostoc sp. Cytochrome b6-f complex subunit 4 (petD) is primarily used in research related to photosynthesis and bioenergetics. It helps scientists understand the mechanisms of electron transport and the role of the cytochrome b6-f complex in cyanobacteria.

4.1. Biotechnological Applications

This protein can be used in biotechnological applications, such as the development of biofuels or in studies aimed at improving photosynthetic efficiency.

Data Tables

Recombinant Nostoc sp. Cytochrome b6-f complex subunit 4 (petD) is a valuable tool for studying photosynthesis and developing biotechnological applications. Its production involves advanced genetic engineering techniques, and its applications span from basic research to potential industrial uses. The diversity in expression hosts and tags allows for flexibility in experimental design and application.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
petD; alr3422; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
petD
Target Protein Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPA MTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKF QNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: ana:alr3422

STRING: 103690.alr3422

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the petD subunit play in Nostoc sp.?

The cytochrome b6-f complex is a hetero-oligomeric membrane protein complex that functions as an essential electron transport intermediary in oxygenic photosynthesis. In cyanobacteria like Nostoc sp., this complex serves as a crucial link between photosystems I and II. The petD gene encodes subunit 4 of this complex, which is one of the core components responsible for maintaining the structural integrity of the dimeric complex and participating in electron transport pathways .

The purified b6-f complex from Nostoc has a stable dimeric structure with eight subunits and electron transport activity comparable to that of Mastigocladus laminosus. The crystal structure of the native b6-f complex from Nostoc has been determined to a resolution of 3.0Å (PDB id: 2ZT9) .

How does the petD subunit in Nostoc sp. differ from its counterparts in other cyanobacteria?

The petD subunit in Nostoc sp. shares significant sequence homology with other cyanobacteria, particularly with Mastigocladus laminosus. The amino acid sequences of the large core subunits (including petD) in Nostoc are approximately 88% identical to those in the M. laminosus b6-f complex .

What methods are commonly used to express and purify recombinant petD from Nostoc sp.?

Expression and purification of recombinant petD from Nostoc sp. typically involves:

  • Cloning Strategy: The petD gene is PCR-amplified from Nostoc sp. genomic DNA using specific primers that incorporate appropriate restriction sites.

  • Expression System Selection: While E. coli is often used as a heterologous host, membrane proteins like petD may require specialized expression systems such as cyanobacterial hosts or cell-free systems for proper folding.

  • Purification Approach: A multi-step purification protocol is generally employed:

    • Cell lysis under conditions that preserve membrane protein integrity

    • Membrane fraction isolation via differential centrifugation

    • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside)

    • Affinity chromatography (typically using histidine tags)

    • Size exclusion chromatography to obtain pure protein

  • Complex Reconstitution: For functional studies, reconstitution of petD with other subunits of the b6-f complex in appropriate lipid environments may be necessary .

How do environmental stressors affect the expression and modification of the petD subunit in Nostoc sp.?

Environmental stressors significantly impact the photosynthetic apparatus in cyanobacteria, including the cytochrome b6-f complex. Research on Nostoc sp. exposed to extreme conditions, such as those at the International Space Station, has revealed non-random genetic alterations predominantly affecting photosystem-associated loci .

Methodology for studying environmental stress effects:

  • Exposure of Nostoc cultures to controlled stressors (UV radiation, desiccation, temperature extremes)

  • RNA-seq analysis to quantify changes in petD expression

  • Proteomic analysis via mass spectrometry to identify post-translational modifications

  • Single-cell genome analysis using microfluidic technology to detect genetic alterations

  • Comparison of protein structures using tertiary structure prediction tools such as RaptorX

What is the relationship between petD mutations and electron transport efficiency in the Nostoc sp. cytochrome b6-f complex?

Mutations in the petD gene can significantly impact the efficiency of electron transport through the cytochrome b6-f complex. The relationship between specific mutations and functional outcomes can be analyzed through:

  • Site-directed mutagenesis of conserved residues in petD to assess their importance in:

    • Protein-protein interactions within the complex

    • Interaction with electron carriers (plastocyanin/cytochrome c6 and plastoquinone)

    • Proton translocation mechanisms

  • Electron transport measurements using:

    • Oxygen electrode systems

    • Spectrophotometric assays tracking cytochrome reduction/oxidation

    • Flash photolysis techniques

  • Structural analysis via:

    • X-ray crystallography of mutant complexes

    • Cryo-electron microscopy for dynamic structural changes

The b6-f complex from Nostoc demonstrates unique structural features, including the orientation of heme bp, which may influence electron transport pathways. The r.m.s.d. between the 3.0-Å crystal structures from M. laminosus and Nostoc is notably large (5.74 Å), particularly due to the 180° rotation of heme bp around the axis of the α- and γ-meso carbon atoms .

What role does the petD subunit play in the dimeric stability of the Nostoc sp. cytochrome b6-f complex?

The petD subunit contributes significantly to the dimeric stability of the cytochrome b6-f complex in Nostoc sp. Research methodologies to investigate this include:

  • Biochemical stability assays:

    • Thermal stability analysis via differential scanning calorimetry

    • Chemical denaturation using chaotropic agents

    • Limited proteolysis to identify protected regions at the dimer interface

  • Mutational analysis targeting:

    • Residues at the putative dimer interface

    • Conserved regions across cyanobacterial species

    • Comparison with unicellular cyanobacteria that do not yield b6-f complex in an intact dimeric state

  • Biophysical characterization:

    • Analytical ultracentrifugation to determine oligomeric state

    • Native gel electrophoresis

    • Cross-linking studies followed by mass spectrometry

The purified b6-f complex from Nostoc exhibits a stable dimeric structure with eight subunits, making it an excellent model for studying the factors contributing to dimer stability . This contrasts with several unicellular cyanobacteria that do not yield b6-f complex in an intact dimeric state with significant electron transport activity, despite having sequenced genomes amenable to mutagenesis .

What are the optimal conditions for expressing recombinant Nostoc sp. petD in heterologous systems?

Optimizing heterologous expression of membrane proteins like petD requires careful consideration of multiple factors:

Expression System Selection:

  • Cyanobacterial hosts (e.g., Synechocystis sp.) provide native-like membrane environments

  • E. coli strains engineered for membrane protein expression (C41/C43, Lemo21)

  • Cell-free systems for toxic or difficult-to-express proteins

Expression Parameters:

ParameterRecommended ConditionsComments
Temperature18-25°CLower temperatures reduce inclusion body formation
Inducer concentration0.1-0.5 mM IPTG for E. coliTitration recommended for each construct
Growth mediaSpecialized media (e.g., TB, 2xYT)Enhanced with membrane-supportive components
Induction timingMid-log phase (OD600 0.6-0.8)Balanced between biomass and expression capacity

Solubilization Strategy:

  • Screen multiple detergents (DDM, LMNG, digitonin)

  • Optimize detergent:protein ratio

  • Consider addition of lipids to stabilize the protein

Fusion Partners:

  • N-terminal fusion tags that enhance membrane targeting

  • Solubility-enhancing tags (MBP, SUMO)

  • Cleavable purification tags (His6, Strep-tag II)

How can researchers effectively reconstitute the functional cytochrome b6-f complex using recombinant petD?

Reconstitution of a functional cytochrome b6-f complex requires the assembly of multiple subunits, including the recombinant petD subunit. A methodological approach includes:

  • Co-expression strategies:

    • Polycistronic expression of multiple subunits

    • Sequential transformation with compatible plasmids

    • Use of artificial operons mirroring native gene organization

  • Reconstitution methodologies:

    • Detergent-mediated reconstitution

    • Liposome incorporation via detergent removal

    • Nanodiscs for single-particle studies

  • Functional validation:

    • Spectroscopic analysis of bound cofactors

    • Electron transfer assays using artificial electron donors/acceptors

    • Proton translocation measurements

  • Structural verification:

    • Negative-stain electron microscopy to confirm complex formation

    • Size-exclusion chromatography coupled with multi-angle light scattering

    • Native mass spectrometry

The reconstituted complex should exhibit properties similar to those of the native Nostoc b6-f complex, including stable dimeric structure and comparable electron transport activity .

What analytical techniques are most informative for characterizing post-translational modifications of the petD subunit?

Post-translational modifications (PTMs) of membrane proteins like petD require specialized analytical approaches:

  • Mass Spectrometry-Based Techniques:

    • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein

    • Targeted MS approaches: Multiple reaction monitoring (MRM)

    • Electron transfer dissociation (ETD) for labile modifications

  • Site-Specific Analysis:

    • Site-directed mutagenesis of potential modification sites

    • Phospho-specific antibodies for phosphorylation detection

    • Chemical labeling strategies for specific modifications

  • Structural Impact Assessment:

    • X-ray crystallography of modified vs. unmodified protein

    • Hydrogen-deuterium exchange mass spectrometry

    • NMR spectroscopy for dynamic structural changes

Research on the Nostoc b6-f complex has revealed unprecedented post-translational modifications, such as N-terminal acetylation of the Rieske iron-sulfur protein (PetC) . Similar modifications might exist in the petD subunit and could be analyzed using the techniques outlined above. N-terminal acetylation is common in eukaryotic proteins but was previously unreported in cyanobacterial membrane and electron transport proteins .

What are common challenges in obtaining high-quality structural data for recombinant Nostoc sp. petD, and how can they be addressed?

Obtaining high-quality structural data for membrane proteins like petD presents several challenges:

Crystal Formation Difficulties:

  • Detergent micelle heterogeneity: Screen multiple detergents and detergent mixtures

  • Limited hydrophilic surface: Use antibody fragments or fusion partners to increase crystal contacts

  • Protein instability: Implement lipid cubic phase crystallization or add stabilizing lipids

Sample Preparation for Cryo-EM:

  • Preferred orientation issues: Use specialized grids (gold, graphene oxide)

  • Low contrast: Optimize defocus range and implement phase plates

  • Conformational heterogeneity: Use focused classification approaches

Data Analysis Challenges:

  • Phase determination: Implement heavy atom derivatives or molecular replacement using related structures

  • Model building: Use secondary structure prediction and evolutionary coupling information

  • Validation: Apply rigorous validation against omit maps and geometric criteria

The crystal structure of the native b6-f complex from Nostoc has been determined to 3.0Å resolution (PDB id: 2ZT9) , providing a valuable template for molecular replacement approaches when studying the recombinant petD subunit or its variants.

How can researchers differentiate between functional and non-functional forms of recombinant petD in biochemical assays?

Differentiating functional from non-functional recombinant petD requires multi-parameter assessment:

Spectroscopic Characterization:

  • Absorption spectroscopy to confirm proper heme incorporation

  • Circular dichroism to verify secondary structure integrity

  • Fluorescence spectroscopy to assess tertiary structure

Functional Assays:

  • Electron transfer activity using artificial donors/acceptors

  • Measurement of proton translocation efficiency

  • Binding assays with interaction partners

Stability Assessment:

  • Thermal shift assays to determine melting temperature

  • Time-dependent activity loss under various conditions

  • Protease sensitivity compared to native protein

Structural Integrity:

  • Size exclusion chromatography profiles

  • Native gel electrophoresis

  • Limited proteolysis patterns

When analyzing the Nostoc b6-f complex, researchers should be particularly attentive to the conformation of heme bp, as its orientation differs significantly from that in other cyanobacterial species and may affect functional readouts .

What statistical approaches are most appropriate for analyzing the effects of site-directed mutations in the petD gene on complex assembly and function?

Analysis of site-directed mutations requires robust statistical frameworks:

Experimental Design Considerations:

  • Include biological replicates (n ≥ 3) for all constructs

  • Incorporate positive controls (wild-type) and negative controls

  • Design factorial experiments when examining multiple variables

  • Consider multivariate approaches for complex phenotypes

Statistical Methods for Different Endpoints:

Endpoint MeasurementRecommended Statistical ApproachConsiderations
Activity MeasurementsANOVA with post-hoc testsVerify assumptions of normality and homoscedasticity
Binding ConstantsNon-linear regression modelsCompare models using AIC/BIC criteria
Stability ParametersSurvival analysis techniquesAccount for time-dependent phenomena
Complex AssemblyRelative quantification with internal standardsNormalize to wild-type for comparison

Advanced Analytical Approaches:

  • Principal component analysis for multiparameter phenotypic data

  • Hierarchical clustering to identify functionally similar mutations

  • Structure-based energy calculations to predict stability effects

  • Molecular dynamics simulations to assess dynamic consequences

How might environmental adaptations of Nostoc sp. influence the evolution of the petD gene and its protein product?

Understanding the environmental adaptations of Nostoc species provides insights into the evolution of the petD gene:

  • Comparative genomic approaches:

    • Analyze petD sequences across Nostoc strains from diverse environments

    • Identify selection signatures using dN/dS ratios

    • Map variations to structural and functional domains

  • Experimental evolution studies:

    • Subject Nostoc cultures to controlled environmental stressors

    • Monitor genomic changes over multiple generations

    • Focus on petD and related genes

  • Ecological correlation analysis:

    • Compare petD variants with habitat characteristics

    • Analyze strain-specific adaptations to extreme environments

    • Correlate genetic changes with physiological measurements

Research has shown that Nostoc species can adapt to extreme conditions, including space exposure . When subjected to a 23-month stay at the International Space Station, Nostoc sp. exhibited non-random genetic alterations, particularly in biofilm and photosystem associated loci . This suggests that environmental pressures can drive specific genetic changes in photosynthetic machinery, potentially including the petD gene.

What are the prospects for using CRISPR-Cas9 technology to study petD function in Nostoc sp.?

CRISPR-Cas9 technology offers powerful approaches for studying petD function:

Genome Editing Strategies:

  • Precise modification of specific residues

  • Domain swapping with homologs from other species

  • Promoter modifications to control expression levels

  • Integration of reporter tags for localization studies

Methodological Considerations for Nostoc:

  • Design of efficient transformation protocols

  • Selection of appropriate Cas9 variants

  • Optimization of guide RNA design for cyanobacterial genomes

  • Development of marker-free editing strategies

Functional Applications:

  • Creation of conditional mutants using inducible systems

  • High-throughput mutagenesis of conserved residues

  • Introduction of non-canonical amino acids for biophysical studies

  • Engineering of strains with enhanced photosynthetic efficiency

Nostoc sp. PCC 7120 has a sequenced genome and is amenable to genetic manipulation , making it a suitable candidate for CRISPR-Cas9 approaches. This provides advantages over other cyanobacteria like M. laminosus, whose genome has not been sequenced despite being used for structural studies of the b6-f complex .

How might structural insights from Nostoc sp. petD inform the engineering of artificial photosynthetic systems?

Structural insights from the petD subunit can inform biomimetic approaches to artificial photosynthesis:

  • Design principles from natural systems:

    • Identification of critical electron transfer pathways

    • Understanding of proton-coupled electron transfer mechanisms

    • Spatial organization of redox cofactors

  • Biomimetic scaffold development:

    • Minimal structural motifs that maintain function

    • Incorporation of natural and synthetic cofactors

    • Optimization of protein-protein interactions

  • Integration with synthetic materials:

    • Interfacing proteins with electrodes

    • Incorporation into nanostructured materials

    • Development of self-assembling systems

The unique structural features of the Nostoc cytochrome b6-f complex, including the distinctive orientation of heme bp , provide valuable insights for designing efficient electron transfer systems. These natural adaptations can inspire the development of artificial systems with enhanced stability and performance under varying environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.