Recombinant Nostoc sp. Cytochrome c biogenesis protein CcsB (ccsB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nostoc sp. Cytochrome c Biogenesis Protein CcsB (ccsB)

Recombinant Nostoc sp. Cytochrome c biogenesis protein CcsB (ccsB) is a crucial component in the biogenesis of cytochromes c, which are essential electron transport proteins found in various organisms, including bacteria and cyanobacteria. The protein CcsB is part of the system II biogenesis pathway, which facilitates the covalent attachment of heme to apocytochrome c, enabling its maturation into functional cytochrome c. This process involves several key proteins, with CcsB playing a pivotal role alongside CcsA in the minimal system II synthetase .

Structure and Function of CcsB

CcsB is a membrane-bound protein that works in conjunction with CcsA to form the cytochrome c synthase complex. This complex is responsible for the delivery and ligation of heme to apocytochrome c in the periplasmic space of bacteria . The protein contains a conserved motif and is part of the heme handling protein (HHP) superfamily, which is involved in heme trafficking and attachment .

Key Features of Recombinant CcsB

  • Species: Nostoc sp.

  • Source: Expressed in E. coli.

  • Tag: His-tagged for purification.

  • Protein Length: Full-length, 1-461 amino acids.

  • Form: Lyophilized powder.

  • Purity: Greater than 90% as determined by SDS-PAGE .

Biogenesis of Cytochromes c

The system II pathway, which includes CcsB, is utilized by various bacteria and cyanobacteria for cytochrome c biogenesis. This pathway involves the reduction of cysteine residues in the apocytochrome c, followed by the transmembrane transport of heme and its covalent attachment via thioether bonds . CcsB, in combination with CcsA, is essential for this process, as it facilitates the heme delivery and ligation steps .

Expression and Purification

Recombinant CcsB is typically expressed in E. coli, allowing for efficient production and purification. The His-tag facilitates affinity purification, making it easier to obtain high-purity protein preparations . This recombinant protein can be used in various biochemical assays to study cytochrome c biogenesis mechanisms.

Potential Applications

The study of recombinant CcsB contributes significantly to understanding the biogenesis of cytochromes c. This knowledge can be applied in biotechnology, particularly in optimizing the production of cytochromes c for use in bioelectrochemical systems or as models for studying electron transport mechanisms . Additionally, insights into the system II pathway can inform strategies for enhancing the efficiency of cytochrome c production in various microbial systems.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
ccsB; ccs1; alr3123; Cytochrome c biogenesis protein CcsB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
ccsB
Target Protein Sequence
MTTDNSAPTASPWWSLPGKFLRREFLPVLTDLRLAIALLLIIALFSISGTVIEQGQSPAF YQSNYPEHPALFGFLTWKVIQVVGLDHVYRTWWFLSLLVLFGTSLTACTFTRQLPALKTA QRWKYYEEPRQFQKLALSAELDAGSVNSLSQILQNRRYKIFQEKDDILYARKGIVGRIGP IIVHIGIVTILLGSIWGAMTGFIAQEMVPSGETFQVKNIIDAGPLAAGQFPQDWSVRVNR FWIDYTPKGGIDQFYSDMSVLDNQGQEVDHKKIFVNQPLRYHGVTFYQTDWGISGVRVRL NKSPIFQLPMALLNTNGQGRIWGTWIPTKPDLSEGVSLLAKDLQGMVLIYDAQGKLVDTV RAGMSTQVNGVTLKVLDVVGSTGLQIKADPGIPIVYTGFGILMLGVVMSYFSHSQIWALQ KGDRLYVGGKTNRAQVAFEQEVLDILERLNSQSATVINQQS
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Database Links

KEGG: ana:alr3123

STRING: 103690.alr3123

Protein Families
Ccs1/CcsB family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.