Recombinant Nostoc sp. Filament integrity protein fraC (fraC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nostoc sp. Filament Integrity Protein FraC (FraC)

Recombinant Nostoc sp. Filament integrity protein FraC (FraC) is a cytoplasmic membrane protein essential for maintaining filament integrity in cyanobacteria like Nostoc and Anabaena. It is part of the fraC operon (fraC, fraD, fraE), which is constitutively expressed under nitrogen deprivation . The recombinant form is produced in E. coli as a full-length protein (1–179 amino acids) with an N-terminal His tag for purification .

Functional roles:

  • Filament Integrity: Required to prevent fragmentation under nitrogen deprivation .

  • Intercellular Transport: Mediates transfer of molecules like calcein (622 Da) and 5-carboxyfluorescein (374 Da), though less efficiently for smaller tracers .

  • Heterocyst Differentiation: Mutants show impaired heterocyst development and diazotrophic growth .

Production details:

ParameterSpecification
Expression SystemE. coli
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; add 5–50% glycerol for stability

Common applications:

  • SDS-PAGE: Used to verify protein integrity and molecular weight .

  • ELISA: Serves as an antigen for antibody production or protein interaction studies .

Research Findings and Functional Insights

Mutant phenotypes:

MutantPhenotype
ΔfraCFilament fragmentation, impaired calcein transfer, defective heterocyst development
ΔfraDSimilar to ΔfraC; altered septal membrane structure in heterocysts
ΔsepJFilament fragmentation, delayed heterocyst differentiation, no diazotrophy

Key discoveries:

  • Molecular Exchange: FraC/FraD-dependent pathways enable intercellular transport independently of SepJ .

  • Structural Role: FraC stabilizes SepJ localization at septa; its absence disrupts heterocyst membrane architecture .

  • Diazotrophic Impact: ΔfraC mutants retain anaerobic nitrogenase activity but fail to form functional heterocysts .

Comparative Analysis with Related Proteins

ProteinFunctionLocalizationMutant Phenotype
FraCFilament integrity, molecular exchangeIntercellular septaFragmentation, impaired calcein transfer
FraDSeptal junction componentIntercellular septaAltered membrane structure
SepJFilament integrity, heterocyst developmentSepta and Z-ringFragmentation, no heterocyst glycolipids
FraHFilament integrity (under N deprivation)Intercellular septaFragmentation, mature heterocysts form

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know and we will prioritize development of that tag.
Synonyms
fraC; alr2392; Filament integrity protein FraC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
fraC
Target Protein Sequence
MFEDLTIPRIWPIGAILFNLLFLLIAIPIEGYIYHRRLNFDKKTSIFYAIAVNSFSGVIG WVIFFFVEPVLPVPIKAELINYIFFNIFRSTNTQGVLIFTTFIIFFSTFLMKFFLLRLFV FTLSEDIGKKQEEPQPFYRQKVRFISRIRLQDTNLVTTTLIANSLSYTAITIILLIRNR
Uniprot No.

Target Background

Function
This protein is involved in filament integrity. It is crucial for the integrity of cell junctions in general, but it does not appear to be directly involved in normal differentiation and nitrogen fixation.
Database Links

KEGG: ana:alr2392

STRING: 103690.alr2392

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is FraC protein and what is its primary function in Nostoc sp.?

FraC (Filament integrity protein C) is a 179-amino acid protein with three predicted transmembrane segments that plays a crucial role in the formation of communication channels between cells in filamentous cyanobacteria like Nostoc sp. These communication channels, also known as septal junctions, are multiprotein complexes that traverse the septal peptidoglycan through nanopores, connecting neighboring cells and enabling molecule transfer along the filament. This intercellular communication system is essential when different cell types in the filament (vegetative cells and heterocysts) need to exchange metabolites and signaling molecules. FraC localizes to the septum connecting vegetative cells, as demonstrated through GFP fusion studies.

What is the relationship between FraC and other filament integrity proteins?

FraC functions as part of a protein network that collectively maintains filament integrity in Nostoc. Three proteins—FraC, FraD, and FraG (also called SepJ)—have been shown to participate in the formation of communication channels between cells. FraC is encoded upstream of and in the same operon as FraD, suggesting coordinated expression and related functions. While direct protein-protein interaction between FraC and FraD has not been demonstrated, recent studies have identified SepN as a potential linker between these two proteins. When SepN was used as bait in co-immunoprecipitation experiments, FraC was detected among the twenty most abundant proteins, suggesting a functional connection. This complex interplay between multiple proteins underscores the sophisticated nature of the intercellular communication system in Nostoc filaments.

What experimental approaches are most effective for studying FraC localization and dynamics in Nostoc filaments?

For effective visualization and analysis of FraC localization and dynamics, researchers should implement the following methodological approaches:

Genetic fusion constructs:

  • Generate C-terminal fusions of FraC to fluorescent proteins (GFP variants) expressed from native promoters to avoid overexpression artifacts

  • Use superfolder GFP (sfGFP) to ensure correct folding, particularly when studying potential periplasmic domains

  • Create photoactivatable or photoconvertible FraC fusions for pulse-chase microscopy experiments

Imaging protocols:

  • Implement fluorescence microscopy with settings optimized for cyanobacterial autofluorescence discrimination

  • Apply fluorescence recovery after photobleaching (FRAP) to measure protein mobility at septa

  • Use time-lapse microscopy to track FraC localization during filament development and cell division

Analytical considerations:

  • Compare FraC localization patterns in vegetative cells versus heterocysts

  • Observe temporal dynamics during cell differentiation and nitrogen step-down

  • Quantify fluorescence intensity at septal regions versus lateral membranes

Research has shown that FraC-GFP fusions localize specifically to the septa connecting vegetative cells, similar to FraD localization patterns. Interestingly, in mature heterocysts cultured for four days after nitrogen step-down, only small fluorescent spots are detected in heterocyst-vegetative cell septa of both terminal and intercalary heterocysts. This differential localization pattern provides important insights into the specialized role of FraC in different cell types within the filament.

How can researchers effectively analyze the role of FraC in intercellular molecular exchange?

Analyzing FraC's role in intercellular molecular exchange requires quantitative approaches that can measure the movement of molecules between cells:

Fluorescent tracer methodologies:

Tracer moleculeMolecular weightMeasurement techniqueExpected outcome in ΔfraC mutants
Calcein622.5 DaFRAP analysisReduced recovery rate
5-CFDA460.4 DaFRAP analysisReduced recovery rate
SYTOX600-800 DaUnidirectional transferImpaired movement

Experimental protocol:

  • Load filaments with membrane-impermeant fluorescent molecules

  • Photobleach fluorescence in target cells using high-intensity laser pulses

  • Measure the rate of fluorescence recovery as an indicator of molecular exchange

  • Calculate intercellular exchange coefficients using mathematical modeling

  • Compare recovery rates between wild-type and fraC mutant strains

Data analysis considerations:

  • Normalize for cell size and initial loading efficiency

  • Account for photobleaching during imaging

  • Implement automated image analysis for objective quantification

  • Consider asymmetrical exchange rates between different cell types

Studies have demonstrated that deletion of fraC results in hampered transfer of calcein and 5-CFDA between cells, confirming its critical role in intercellular molecular exchange. This methodological approach allows researchers to quantitatively assess the functional impact of FraC mutations or environmental conditions on cell-cell communication.

What methods are most effective for investigating protein-protein interactions involving FraC?

Investigating protein-protein interactions involving the membrane protein FraC requires specialized approaches:

Co-immunoprecipitation strategies:

  • Use epitope-tagged versions of FraC as bait proteins

  • Apply mild detergents for membrane solubilization that preserve protein-protein interactions

  • Consider crosslinking with agents like glutaraldehyde to stabilize transient interactions

  • Analyze precipitated proteins using mass spectrometry for unbiased interaction mapping

  • Validate findings with reverse co-immunoprecipitation using identified partners as bait

Proximity-based labeling approaches:

  • Generate FraC fusions with enzymes like BioID or APEX2

  • Express in Nostoc under native regulation

  • Identify proteins in close proximity through biotinylation and subsequent purification

  • Compare interactomes under various conditions (nitrogen replete vs. depleted)

Validation methods:

  • Fluorescence co-localization of potential interaction partners

  • Bimolecular fluorescence complementation (BiFC) for direct interaction visualization

  • Förster resonance energy transfer (FRET) for measuring interaction distances

Co-immunoprecipitation studies using FraD as bait have successfully identified interactions with SepN, which may serve as a linker between FraC and FraD. In reverse co-immunoprecipitation using GFP-SepN as bait, FraD was the most abundant protein detected, while FraC was also identified among the twenty most abundant proteins, particularly after glutaraldehyde treatment. These findings demonstrate the effectiveness of co-immunoprecipitation approaches in unraveling the protein interaction network involving FraC.

How does FraC contribute to heterocyst development and function in Nostoc?

Investigating FraC's role in heterocyst development requires systematic approaches that address both developmental and functional aspects:

Heterocyst differentiation analysis:

  • Monitor heterocyst frequency and spacing pattern in wild-type versus ΔfraC strains

  • Track the expression of heterocyst-specific genes during differentiation

  • Analyze polysaccharide layer formation through Alcian blue staining

  • Assess the distribution of pattern-determining factors like PatS and HetN

Nitrogen fixation assessment:

  • Measure nitrogenase activity using acetylene reduction assay

  • Quantify expression of nitrogenase components (nifH, nifD) via RT-qPCR

  • Monitor growth rates under diazotrophic conditions

  • Analyze 15N incorporation to assess nitrogen fixation efficiency

Intercellular exchange in heterocyst-vegetative cell junctions:

  • Trace metabolite exchange between heterocysts and adjacent vegetative cells

  • Measure the transfer of fixed nitrogen compounds along filaments

  • Assess carbon transport from vegetative cells to heterocysts

Research has shown that FraC localizes differently in mature heterocysts compared to vegetative cells, with only small fluorescent spots detected in heterocyst-vegetative cell septa. This differential localization suggests a specialized role in facilitating controlled exchange between heterocysts and vegetative cells. Understanding this aspect is crucial as intercellular communication is essential when different cell types in the filament need to exchange metabolites and signaling molecules during nitrogen fixation.

How does the function of FraC relate to the carbon-concentrating mechanisms in Nostoc?

The relationship between FraC function and carbon metabolism in Nostoc represents an important research area:

Carbon limitation response:

  • Compare growth of wild-type and ΔfraC strains under carbon-limiting conditions

  • Analyze the impact of FraC deletion on RubisCO localization and activity

  • Assess the exchange of carbon compounds between cells in the filament

  • Measure carbon fixation rates in relation to intercellular communication efficiency

Experimental considerations:

  • Control CO2 and bicarbonate levels precisely during experiments

  • Monitor changes in carbon metabolism during nitrogen step-down

  • Analyze the coordination between carbon and nitrogen metabolism

Recent studies suggest that Nostoc strains may exhibit an almost obligate dependence on heterotrophic partners under carbon-limiting conditions. The prevalent extracarboxysomal localization of RubisCO in N. punctiforme indicates a weak carbon-concentrating mechanism that may enforce dependence on metabolic partners. While not directly linked to FraC in the current literature, investigating how septal junction proteins like FraC facilitate carbon distribution throughout filaments could provide valuable insights into this dependency relationship.

What are the latest approaches for structural analysis of FraC and its integration into septal junction complexes?

Understanding the structure of FraC and its integration into septal junction complexes requires advanced structural biology approaches:

Cryo-electron tomography pipeline:

  • Prepare Nostoc filaments using plunge-freezing to maintain native structure

  • Implement focused ion beam (FIB) milling to create thin cellular lamellae

  • Acquire tomographic tilt series focusing on septal regions

  • Perform sub-tomogram averaging to enhance structural details

  • Apply computational classification methods to sort heterogeneous structures

Integrative structural biology:

  • Combine data from multiple experimental techniques

  • Apply computational modeling to integrate diverse structural constraints

  • Develop simulations of septal junction assembly in realistic membrane environments

  • Create architectural models incorporating protein-protein and protein-lipid interactions

Validation approaches:

  • Generate targeted mutations based on structural predictions

  • Assess the impact on protein localization and function

  • Correlate structural features with intercellular communication efficiency

Cryo-electron tomography of FIB-thinned filaments has successfully revealed that septal junctions exhibit a five-fold symmetric cytoplasmic cap module, a cytoplasmic membrane-embedded plug domain, and a tube that traverses the septal peptidoglycan. While FraD has been localized to the plug domain, the exact placement of FraC within this structure remains to be determined. These advanced imaging approaches provide unprecedented insights into the molecular architecture of septal junctions and will be crucial for understanding FraC's structural role.

What are the optimal conditions for expressing recombinant FraC protein?

Successful expression of recombinant FraC requires careful consideration of its membrane protein nature:

Expression system selection:

  • For structural studies: E. coli strains optimized for membrane protein expression (C41/C43(DE3))

  • For functional studies: Cyanobacterial expression systems to ensure proper folding and modification

  • Consider cell-free expression systems for difficult-to-express constructs

Vector design considerations:

  • Include affinity tags (His6, Strep-tag) for purification

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Include protease cleavage sites for tag removal

  • Optimize codon usage for the chosen expression host

Expression conditions:

  • Use low inducer concentrations and reduced temperatures (16-20°C)

  • Implement extended expression times for proper membrane insertion

  • Consider the addition of specific lipids to expression media

Purification strategy:

  • Select mild detergents for membrane extraction (DDM, LMNG)

  • Implement two-step purification (affinity + size exclusion chromatography)

  • Validate protein integrity through functional assays

These methodological considerations are essential for obtaining properly folded and functional recombinant FraC for downstream structural and functional studies.

How can researchers effectively design mutations in fraC to study structure-function relationships?

Designing informative mutations in fraC requires a strategic approach combining bioinformatic analysis with careful experimental design:

Computational analysis:

  • Perform multiple sequence alignments of FraC homologs to identify conserved residues

  • Use topology prediction tools to map transmembrane segments precisely

  • Apply homology modeling if structural templates exist for related proteins

Strategic mutation targets:

RegionMutation strategyFunctional assessment
Transmembrane segmentsAlanine scanningMembrane integration, protein stability
Predicted interaction interfacesCharge reversalProtein-protein interactions
Conserved motifsConservative substitutionsSpecific functional roles
Terminal domainsTruncationsDomain contributions

Phenotypic analysis pipeline:

  • Express mutants with fluorescent tags to assess localization

  • Quantify filament fragmentation rates under nitrogen deprivation

  • Measure intercellular molecular exchange using fluorescent tracers

  • Perform co-immunoprecipitation with known interaction partners to assess complex formation

Validation approaches:

  • Complement deletion mutants with mutated versions to confirm functional relevance

  • Use site-specific crosslinking to validate predicted interaction interfaces

  • Apply biochemical assays to assess specific functional properties

This comprehensive approach enables researchers to systematically map the relationship between specific protein regions and their contributions to FraC function in septal junction formation and intercellular communication.

What environmental factors influence FraC expression and function, and how can these effects be measured?

Environmental regulation of FraC expression and function represents an important research area requiring systematic approaches:

Key environmental variables:

  • Nitrogen availability (fixed nitrogen vs. diazotrophic conditions)

  • Light intensity and quality

  • Carbon availability (CO2 levels, bicarbonate concentration)

  • Temperature fluctuations

  • Metal ion availability (particularly iron)

Expression analysis methods:

  • Develop promoter-reporter fusions (PfraC-gfp) to visualize expression patterns

  • Implement RT-qPCR for accurate quantification across conditions

  • Perform RNA-seq for genome-wide contextual understanding

  • Create translational fusions to monitor protein levels in vivo

Functional impact assessment:

  • Measure intercellular molecular exchange rates under varying conditions

  • Assess protein localization patterns in response to environmental changes

  • Monitor filament integrity under stress conditions

  • Correlate expression levels with functional outcomes

Research has shown that Nostoc strains exhibit complex responses to environmental factors, including competition for iron and facilitation for carbon when interacting with heterotrophic partners. Iron limitation can trigger upregulation of alternative electron transfer proteins and siderophore production. Understanding how these environmental factors influence FraC expression and function could provide insights into the adaptive strategies of Nostoc filaments under varying conditions.

How does FraC contribute to the ecological adaptability of Nostoc in symbiotic relationships?

Nostoc's ability to form symbiotic relationships with plants while also serving as a hub for heterotrophic bacteria represents a fascinating research area:

Research approaches:

  • Compare FraC expression and function in free-living versus symbiotic Nostoc

  • Analyze the impact of symbiotic partners on FraC-mediated intercellular communication

  • Investigate how FraC contributes to nutrient exchange in symbiotic contexts

  • Assess the evolutionary conservation of FraC in symbiotic versus non-symbiotic cyanobacteria

Methodological considerations:

  • Develop co-culture systems to mimic natural symbiotic conditions

  • Implement isotope labeling to track nutrient exchange

  • Apply genetic tools to manipulate FraC expression in symbiotic contexts

  • Use comparative genomics to identify symbiosis-specific variations in FraC sequence and regulation

Studies have demonstrated that Nostoc strains show an almost obligate dependence on heterotrophic partners under carbon-limiting conditions, suggesting limited autonomy that may explain their preference for symbiotic interactions. Understanding FraC's role in this context could provide valuable insights into the molecular basis of Nostoc's ecological adaptability.

What is the evolutionary significance of FraC in the development of multicellularity in cyanobacteria?

The evolution of multicellularity in cyanobacteria represents a fundamental transition in biological complexity:

Evolutionary analysis approaches:

  • Conduct comprehensive phylogenetic analysis of FraC across cyanobacterial lineages

  • Compare FraC structure and function between unicellular, filamentous, and branching cyanobacteria

  • Identify genetic innovations associated with FraC evolution

  • Analyze selective pressures on different FraC domains across evolutionary time

Experimental strategies:

  • Express ancestral FraC reconstructions in modern cyanobacteria

  • Test functional complementation across evolutionary distant species

  • Identify minimal FraC elements required for intercellular communication

  • Map evolutionary changes to specific functional innovations

This research direction could provide fundamental insights into how protein innovations like FraC contributed to the emergence of multicellular organization in cyanobacteria, one of the earliest examples of multicellularity on Earth.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.