Recombinant Nostoc sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Role and Enzymatic Activity

PlsY belongs to the glycerol-3-phosphate acyltransferase (GPAT) family, which determines the regiospecificity of acylation in glycerolipid biosynthesis. Unlike eukaryotic GPATs that typically acylate the sn-1 position of G3P, cyanobacterial PlsY transfers acyl groups to the sn-2 position, producing lysophosphatidic acid (LPA) or monoacylglycerol (MAG) via bifunctional acyltransferase/phosphatase activity . This sn-2 preference is critical for synthesizing specialized lipids like cutin in plants, suggesting evolutionary divergence in cyanobacterial lipid metabolism .

Key catalytic features:

  • Substrates: Acyl-phosphate (not acyl-CoA or acyl-ACP) .

  • Products: sn-2 MAG or LPA, depending on phosphatase activity .

  • Conserved motifs: Includes an N-terminal phosphatase domain (HAD-like hydrolase superfamily) and a C-terminal PlsC-type acyltransferase domain .

Biotechnological Applications

Recombinant PlsY is utilized in metabolic engineering to optimize fatty acid production. For example:

  • Biofuel Research: Co-expression with thioesterases in Synechocystis sp. enhances free fatty acid yields by redirecting acyl-ACP pools toward lipid synthesis .

  • Membrane Engineering: Modifies lipid composition in host organisms to improve stress tolerance or product secretion .

Case Study:
In Synechocystis sp. PCC 6803, combining PlsY overexpression with acyl-ACP synthetase knockout increased C16:0 and C18:1 fatty acid production by 30–50% .

Research Findings and Comparative Analysis

  • Catalytic Mechanism: The phosphatase domain of PlsY hydrolyzes the phosphate group from acyl-phosphate, enabling a two-step reaction (acylation followed by dephosphorylation) .

  • Evolutionary Insight: Cyanobacterial PlsY’s sn-2 specificity contrasts with Arabidopsis GPATs, which exhibit dual sn-1/sn-2 activities .

  • Recombinant Production: Available commercially (e.g., MyBioSource MBS7026428) with >85% purity, expressed in E. coli .

Open Questions and Future Directions

  • Does PlsY’s sn-2 activity influence membrane fluidity in extremophilic cyanobacteria?

  • Can engineered PlsY variants improve lipid yields in industrial algae strains?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we can accommodate special requirements for the format. Please specify your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50% and serves as a reference.
Shelf Life
The shelf life of the product can be influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
plsY; all0492; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
plsY
Target Protein Sequence
MGFWLSLCGAVVLVAYLLGSFPTGYIAVKQLKGIDIREVGSGSTGATNVLRTLGKGPGAF VLGLDCLKGVLAIALVYYLFTFASNQNLIPTTVNIELWQPWLVTLAGIAAILGHSKSIFL GFTGGKSVATSLGILLAMNWQVGLATFGVFAVVVAISRIVSLSSIMGAIAVSIVMVFLQQ PLPYILFGIAGGLYVILRHRSNIERLLAGTEPKIGQKLVTETEQSA
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor but does not use acyl-CoA or acyl-ACP.
Database Links

KEGG: ana:all0492

STRING: 103690.all0492

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.