Recombinant Nostoc sp. Heterocyst differentiation ATP-binding protein HepA (hepA)

Shipped with Ice Packs
In Stock

Description

Regulatory Interactions

  • Upstream elements: A 171-bp region (-707 to -536 bp upstream of hepA) is essential for nitrogen starvation-induced transcription. Deletion abolishes induction .

  • HepC dependency: Inactivation of hepC (encoding a UDP-galactose transferase) causes constitutive hepA expression and disrupts heterocyst polysaccharide synthesis. HepC likely regulates hepA indirectly via metabolite signaling rather than direct DNA binding .

  • HepK involvement: The histidine kinase HepK (similar to Synechocystis helicase II) is required for hepA induction. Mutants lacking hepK show no hepA activation post-nitrogen deprivation .

Transcriptional Inhibition by BMAA

The neurotoxin β-N-methylamino-L-alanine (BMAA) downregulates hepA during nitrogen starvation, blocking heterocyst differentiation. Co-inhibition of hetR (master heterocyst regulator) and hepA by BMAA leads to cell death under nitrogen limitation .

Domain Architecture

RegionAmino Acid RangeFunction
ATP-binding domain450-607Binds ATP, drives polysaccharide export
Transmembrane helix120-140Membrane localization
Leucine zipper280-310Dimerization (predicted)

The ATP-binding domain is critical for energizing heterocyst envelope glycolipid and polysaccharide transport. Structural predictions suggest HepA forms oligomers via its leucine zipper motif .

Applications in Research

  • Heterocyst studies: Used to probe regulatory networks in Nostoc PCC 7120 under nitrogen stress .

  • Protein interaction assays: His-tagged recombinant HepA enables pull-down studies to identify binding partners (e.g., HepC, transcriptional regulators) .

  • Enzyme kinetics: ATPase activity assays quantify energy utilization during heterocyst maturation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have specific tag requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
hepA; hetA; alr2835; Heterocyst differentiation ATP-binding protein HepA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-607
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
hepA
Target Protein Sequence
MPKSPHKLFKANSFWKENNLILREIKHFRKIAILAVIFSFLAASFEGVSIGFLLSFLQKL TSPNDPIQTGISWVDMILAADAWPIPPIYRISLLILLSTWMRATFNYFGGVYTESAQLNL ADRLHKQIFEQLQALRLSYFAQTRSGELINTITTEIERIKQGFSGLAFVLTRIMTVCVYF VVMFSISWQLSIISVLIFLLLAVGLSTLNKRVRETSFGISHANAQFTAVAVEFINGIRTI QAFGTQEFERQRFYKASTNQLNAAIKVVLAWTLVKPIAEGIATTVLISLIVISFATFTLP VASLLTFFFVLVRVIPNIQDINGTVAFLSTLQGSSENIKNILQTNNKPYLKNGKLHFQGL KRSIDLVSVDFGYTADNLVLNNITLTIERGKTTALVGASGAGKTTLADLIPRFYDPTEGQ ILVDGLDVQYFEINSLRRKMAVVSQDTFIFNTSIRDNIAYGTSGASEAEIREVARLANAL QFIEEMPEGFDTKLGDRGVRLSGGQRQRIAIARALLRDPEILILDEATSALDSVSERLIQ ESIEKLSVGRTVIAIAHRLSTIAKADKVVVMEQGRIVEQGNYQELLEQRGKLWKYHQMQH ESGQTNS
Uniprot No.

Target Background

Function
Plays a crucial role in the early stages of heterocyst morphological differentiation.
Database Links

KEGG: ana:alr2835

STRING: 103690.alr2835

Protein Families
ABC transporter superfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant HepA protein?

For optimal expression of recombinant HepA protein, E. coli-based expression systems have proven most effective. The recommended protocol involves:

  • Cloning the full-length gene (1-607aa) into an expression vector with an N-terminal His-tag

  • Transforming the construct into E. coli expression strains

  • Inducing expression under controlled conditions

  • Purifying using affinity chromatography

The resulting protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis. For functional studies, expression in insect cell systems (such as Sf9 cells) may provide protein with more native-like post-translational modifications, similar to approaches used for other ATP-binding proteins .

How should researchers handle and store recombinant HepA protein to maintain its stability?

Proper handling and storage of recombinant HepA protein is critical for maintaining its functional properties. Based on established protocols, researchers should:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for no longer than one week

  • Use Tris/PBS-based buffer (pH 8.0) with 6% trehalose for optimal stability

It is strongly recommended to briefly centrifuge the vial prior to opening to ensure all contents are at the bottom of the tube. Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided .

What methodologies are most effective for measuring HepA ATPase activity?

For quantifying HepA ATPase activity, researchers should adapt protocols similar to those used for other ATP-binding cassette proteins. The recommended methodology includes:

  • Prepare protein samples with standardized concentration (using purified recombinant protein)

  • Set up reaction mixtures containing varying ATP concentrations (0.5-10 mM range)

  • Incubate at 37°C for 30-60 minutes

  • Measure inorganic phosphate (Pi) release using colorimetric assays

  • Calculate kinetic parameters by fitting data to Michaelis-Menten equations

ParameterControl MembranesHepA (predicted)Reference for Methodology
Kd (ATP)LowerHigherATP-binding cassette studies
BmaxLower4.0-6.0 mM (predicted)Comparable to hABCC4
VmaxLowerSignificantly higherStandardized by protein amount

When designing these experiments, include untransfected membrane preparations as controls and subtract their activity to obtain HepA-specific ATPase measurements. This approach has been validated for other ATP-binding proteins and should be effective for HepA characterization .

How does HepA function in the regulatory pathway of heterocyst differentiation?

HepA plays a critical role in the molecular machinery governing heterocyst differentiation in Nostoc sp. Research indicates:

  • HepA is part of a regulatory network including other heterocyst-specific genes like hetR

  • Under nitrogen starvation conditions, HepA expression is upregulated to support heterocyst development

  • When exposed to BMAA (β-N-methylamino-L-alanine), transcription of hepA is downregulated, preventing heterocyst formation

  • This downregulation coincides with inhibition of nitrogen fixation, suggesting HepA's importance in this process

The exact mechanism of HepA's contribution to heterocyst differentiation likely involves ATP-dependent processes, potentially including transport of essential molecules or energizing developmental changes in the differentiating cell .

How can researchers distinguish between direct and indirect effects of HepA on heterocyst development?

Differentiating between direct and indirect effects of HepA on heterocyst development requires sophisticated experimental approaches:

  • Temporal gene expression analysis:

    • Monitor hepA expression timing relative to other heterocyst genes

    • Use RNA-seq at different timepoints during nitrogen deprivation

    • Correlate expression patterns with morphological changes

  • Genetic approaches:

    • Generate conditional mutants with inducible expression

    • Perform epistasis analysis with other heterocyst genes (particularly hetR)

    • Create point mutations in ATP-binding domains to separate ATPase activity from other functions

  • Biochemical methods:

    • Identify direct interaction partners using pull-down assays

    • Employ chemical crosslinking followed by mass spectrometry

    • Reconstitute minimal systems in vitro to test direct regulatory interactions

When BMAA is added to Nostoc cultures under nitrogen starvation, it prevents heterocyst formation by downregulating both hetR and hepA genes. By analyzing the time course of these effects, researchers can determine whether HepA acts upstream, downstream, or in parallel to other heterocyst differentiation factors .

How does the ATPase activity of HepA compare to other ATP-binding cassette proteins?

The ATPase activity of HepA can be analyzed in comparison to other well-characterized ATP-binding cassette proteins. Based on studies of related proteins:

ProteinATP DependencePhosphorylation RequirementMax ATPase ActivityRegulatory Mechanism
hABCC4Concentration-dependentNo PKA requiredHigh VmaxATP binding only
hCFTRConcentration-dependentPKA-dependentHigher than Lp-CFTRPhosphorylation + ATP
Lp-CFTRConcentration-dependentPKA-dependentLower than hCFTRPhosphorylation + ATP
HepAPredicted concentration-dependentUnknownPredicted highLikely ATP-dependent

To characterize HepA's ATPase activity properly, researchers should:

  • Determine if activity requires phosphorylation (like CFTR) or is ATP-dependent only (like ABCC4)

  • Measure ATP concentration dependence to calculate Kd and Bmax values

  • Compare maximum velocity (Vmax) when standardized by protein amount

  • Investigate whether HepA activity is regulated by other factors specific to heterocyst development .

What structural domains of HepA are critical for its ATP-binding function?

The HepA protein contains several structural domains critical for its ATP-binding and hydrolysis functions:

  • Walker A motif (P-loop): This conserved sequence (typically GXXGXGKS/T) is essential for binding the phosphate groups of ATP

  • Walker B motif: Contains conserved aspartate residues necessary for coordinating Mg2+ and catalyzing ATP hydrolysis

  • Signature sequence: Characteristic of ABC transporters, this region undergoes conformational changes during the ATP binding/hydrolysis cycle

  • Transmembrane domains: Based on sequence analysis, HepA likely contains membrane-spanning regions that anchor it to cellular membranes

To identify these critical domains experimentally, researchers should:

  • Perform site-directed mutagenesis of key residues in the ATP-binding pocket

  • Generate truncation constructs to identify minimal functional units

  • Use molecular modeling based on related ABC transporters with known structures

  • Conduct comparative sequence analysis across different cyanobacterial species .

How do environmental factors influence HepA expression and function in Nostoc sp.?

HepA expression and function are regulated by several environmental factors, with nitrogen availability being the primary signal:

  • Nitrogen status:

    • Under nitrogen deprivation, hepA expression increases as part of heterocyst differentiation program

    • In nitrogen-replete conditions, hepA expression is suppressed

    • This regulation likely involves the global nitrogen regulator NtcA

  • BMAA exposure:

    • The neurotoxin BMAA downregulates hepA transcription during nitrogen deprivation

    • This prevents heterocyst formation and leads to nitrogen starvation

    • Interestingly, BMAA has an opposite regulatory effect under nitrogen-replete conditions

  • Other potential environmental influences:

    • Light intensity (affects energy availability for heterocyst development)

    • Carbon availability (heterocysts require carbon skeletons from vegetative cells)

    • Temperature (affects protein folding and enzyme kinetics)

To study these environmental effects, researchers should employ transcriptional reporter fusions, quantitative RT-PCR, and protein level analysis under controlled environmental conditions .

What are the transcriptional and post-translational regulatory mechanisms controlling HepA activity?

The regulation of HepA occurs at multiple levels, ensuring precise control over heterocyst differentiation:

  • Transcriptional regulation:

    • Nitrogen-responsive transcription factors (likely including NtcA) regulate hepA expression

    • Co-regulation with other heterocyst genes suggests shared regulatory elements

    • BMAA influences hepA transcription, indicating sensitivity to specific signaling molecules

  • Predicted post-translational regulation (based on studies of related ABC proteins):

    • Phosphorylation: Many ABC transporters are regulated by phosphorylation

    • Protein-protein interactions: Association with other proteins may modulate activity

    • Conformational changes: ATP binding and hydrolysis induce structural shifts

  • Methodological approaches for investigation:

    • Promoter analysis to identify regulatory elements

    • Phosphoproteomic analysis to detect modification sites

    • Interactome studies to identify regulatory binding partners

    • In vitro reconstitution to test direct effects of regulatory factors .

How can researchers resolve contradictory findings regarding HepA function in different cyanobacterial species?

Resolving contradictory findings about HepA function across cyanobacterial species requires systematic comparative approaches:

  • Standardized experimental conditions:

    • Use identical growth conditions, nitrogen starvation protocols, and analytical methods

    • Employ the same genetic manipulation techniques across species

    • Standardize protein expression and purification protocols

  • Cross-species complementation:

    • Express HepA from different species in a common hepA-deficient background

    • Assess functional complementation by monitoring heterocyst formation

    • Identify species-specific differences in protein function

  • Domain swapping experiments:

    • Create chimeric proteins with domains from different species

    • Identify which regions confer species-specific functions

    • Map functional differences to specific amino acid changes

  • Comprehensive phylogenetic analysis:

    • Correlate HepA sequence variations with functional differences

    • Identify co-evolving proteins that may explain functional divergence

    • Consider evolutionary adaptations to different ecological niches

When analyzing contradictory findings, researchers should carefully consider differences in experimental design, growth conditions, and genetic backgrounds that might explain discrepancies between studies.

What novel experimental approaches could advance our understanding of HepA's role in heterocyst differentiation?

Several cutting-edge techniques could significantly advance our understanding of HepA's role:

  • Cryo-electron microscopy:

    • Determine high-resolution structure of HepA in different conformational states

    • Visualize ATP binding and hydrolysis-induced structural changes

    • Identify potential interaction surfaces

  • Single-cell transcriptomics:

    • Profile gene expression in individual cells along cyanobacterial filaments

    • Correlate HepA expression with heterocyst developmental stages

    • Identify cell-specific regulatory networks

  • Optogenetic control of HepA expression:

    • Develop light-inducible hepA expression systems

    • Control HepA activity with temporal and spatial precision

    • Determine critical timing of HepA function during differentiation

  • In vitro reconstitution systems:

    • Reconstitute HepA in artificial membrane systems

    • Identify transport substrates or regulatory targets

    • Measure ATP hydrolysis coupled to specific functions

  • CRISPR-Cas9 base editing:

    • Introduce precise mutations in hepA without disrupting the gene

    • Create allelic series to separate different functional aspects

    • Map structure-function relationships with minimal perturbation to cellular systems

These advanced approaches would provide more mechanistic insights than traditional genetic knockouts or overexpression studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.