Recombinant Nostoc sp. Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role of lspA

Lipoprotein signal peptidase (lspA) is an aspartic acid protease responsible for processing prolipoproteins by cleaving their N-terminal signal peptides after lipid modification by prolipoprotein diacylglyceryl transferase (Lgt) . This step is essential for lipoprotein maturation and membrane localization in Gram-negative bacteria. While lspA homologs are conserved across bacterial species, its functional characterization in cyanobacteria like Nostoc remains underexplored.

A. Functional Characterization in Rickettsia typhi

  • Expression Patterns: lspA transcription peaks during late intracellular growth stages, correlating with lipoprotein secretion .

  • Genetic Complementation: R. typhi lspA restores growth in temperature-sensitive E. coli mutants, confirming enzymatic activity .

  • Substrate Specificity: Processes ~14 predicted lipoproteins in R. typhi, while SPase I (LepB) handles nonlipoprotein secretion .

Gaps in Nostoc sp. lspA Research

Knowledge GapPotential Implications
Lack of Direct StudiesNo published data on Nostoc lspA structure, expression, or substrate specificity.
Functional RedundancyOverlap with SPase I (LepB) in other bacteria may obscure Nostoc lspA’s role.
Ecological ContextUnexplored link between lspA activity and Nostoc’s survival in extreme environments.

Hypothetical Applications and Future Directions

AreaPotential Research Focus
Antibiotic DevelopmentDesigning lspA inhibitors targeting conserved active sites for cyanobacterial control.
Biotechnological UseEngineering lspA for heterologous lipoprotein production in Nostoc.
Environmental AdaptationInvestigating lspA’s role in Nostoc’s ice-binding protein (IBP) secretion .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing it accordingly.
Synonyms
lspA; alr4577; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
lspA
Target Protein Sequence
MRFKNRLFWIAAFIAFFVDQLTKYWVVQTFSLGETLPILPGIFHFTYVTNTGAAFSLFSG KVEWLRWLSLGVSLLLIGLALLGPVLDRWDQLGYGLILGGAMGNGIDRFALGYVVDFLDF RLINFAVFNMADSFISIGIVCLLLASLQKPPSSHHRPR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: ana:alr4577

STRING: 103690.alr4577

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Lipoprotein Signal Peptidase (LspA) in bacterial systems?

Lipoprotein signal peptidase (LspA) is an aspartyl protease that plays a critical role in the lipoprotein-processing pathway by cleaving the transmembrane helix signal peptide of lipoproteins. This enzymatic activity is essential for proper bacterial lipoprotein maturation and localization to the cell membrane. The protease contains a catalytic dyad and 14 additional highly conserved residues surrounding the active site, indicating the functional importance of this region for enzymatic activity . In Nostoc sp., as in other bacterial species, LspA is involved in processing lipoproteins that may contribute to various cellular functions including nitrogen fixation capabilities .

Why is LspA considered a potential antibiotic target in research?

LspA represents an excellent target for antibiotic development based on several key characteristics that make it both effective and potentially resistant to development of antimicrobial resistance. It is essential for viability in Gram-negative bacteria and contributes significantly to virulence in Gram-positive bacteria, making it critical for bacterial survival and pathogenicity. The extensive conservation of the active site residues suggests that resistance mutations arising within the active site would likely interfere with the enzyme's natural function of binding and cleaving substrates . This characteristic creates a high genetic barrier to resistance development, as mutations that would prevent antibiotic binding would also likely impair the enzyme's essential functions, making LspA-targeting antibiotics potentially more sustainable than conventional antimicrobials.

What conformational states does LspA adopt and how do they relate to function?

LspA exhibits remarkable conformational plasticity that directly correlates with its functional capabilities. Molecular dynamics simulations and electron paramagnetic resonance (EPR) studies have identified three main conformational states: closed, intermediate, and open . In the closed conformation, which dominates in the apo state, the periplasmic helix (PH) and β-cradle are positioned approximately 6.2 Å apart, effectively occluding the charged and polar active site residues from the lipid bilayer. This conformation likely protects the catalytic residues when no substrate is present.

The intermediate conformation, observed predominantly in the globomycin-bound state, represents a partially open active site that may facilitate initial substrate recognition. The open conformation, though less populated and primarily observed in molecular dynamics simulations, creates a trigonal cavity that would sterically accommodate the prolipoprotein substrate in the correct orientation for signal peptide cleavage .

These conformational transitions occur on the nanosecond timescale and are essential for LspA's ability to bind diverse substrates. The dynamic equilibrium between these states explains how LspA can process various lipoprotein substrates while maintaining specificity. This conformational flexibility is likely conserved in Nostoc sp. LspA, though species-specific variations in the relative populations of each state may exist.

How does antibiotic binding affect the conformational dynamics of LspA?

Antibiotic binding significantly alters the conformational equilibrium of LspA, shifting the population distribution among its conformational states. When globomycin binds to LspA, the enzyme predominantly adopts the intermediate conformation, with the periplasmic helix positioned to partially expose the active site . This stands in contrast to the apo state, where the closed conformation predominates.

Experimental evidence from continuous-wave (CW) EPR and double electron-electron resonance (DEER) studies reveals that globomycin binding creates multiple distance populations between the β-cradle and periplasmic helix, indicating multiple binding modes . This conformational heterogeneity suggests that globomycin's inhibitory mechanism involves stabilizing conformations that prevent the enzyme from adopting the fully open state required for substrate processing.

The antibiotic effectively locks LspA in conformations incompatible with proper substrate binding and catalysis, preventing both signal peptide cleavage and potentially blocking substrate access to the active site. This mechanism of inhibition through conformational restriction represents a sophisticated approach that might inform the design of novel antibiotics targeting Nostoc sp. LspA and related bacterial enzymes.

What techniques are most effective for studying LspA conformational dynamics?

A hybrid experimental approach combining computational and biophysical methods has proven most effective for elucidating the complex conformational dynamics of LspA. The following methodological framework is recommended:

Table 1: Complementary Techniques for LspA Conformational Analysis

TechniqueApplicationAdvantagesLimitations
Molecular Dynamics (MD) SimulationsMapping conformational landscape, tracking nanosecond-scale motionsProvides atomic-level detail of dynamic processesRequires validation with experimental data
Continuous-Wave EPRMeasuring site-specific mobility and conformational changesDetects nanosecond timescale dynamics, minimal sample requirementsRequires site-directed spin labeling
Double Electron-Electron Resonance (DEER)Measuring distances between specific residuesProvides distance distributions between labeled sitesLower sensitivity than CW EPR
X-ray CrystallographyHigh-resolution static structuresAtomic resolution of protein structureMay miss dynamic states, crystallization challenges

For optimal results, researchers should implement site-directed spin labeling (SDSL) at strategically selected residues, particularly focusing on the periplasmic helix and β-cradle regions that undergo significant conformational changes . The spin-labeled variants should be analyzed using CW EPR to assess mobility changes upon ligand binding, followed by DEER measurements to determine distance distributions between labeled sites in different functional states.

These experimental data should then be integrated with MD simulations to generate ensemble models that capture the full range of conformational states. This integrative approach has successfully revealed conformations not observed in crystal structures alone, highlighting its value for comprehensive characterization of membrane enzyme dynamics .

What expression and purification protocols are recommended for recombinant Nostoc sp. LspA?

Based on established protocols for LspA from other bacterial species, the following optimized expression and purification protocol is recommended for recombinant Nostoc sp. LspA:

  • Vector Construction: Clone the Nostoc sp. lspA gene (full sequence: MRFKNRLFWIAAFIAFFVDQLTKYWVVQTFSLGETLPILPGIFHFTYVTNTGAAFSLFSGKVEWLRWLSLGVSLLLIGLALLGPVLDRWDQLGYGLILGGAMGNGIDRFALGYVVDFLDFRLINFAVFNMADSFISIGIVCLLLASLQKPPSSHHRPR) into a pET28b vector with an N-terminal 6xHis tag and thrombin cleavage sequence .

  • Expression System: Transform the construct into E. coli C43(DE3) cells, which are optimized for membrane protein expression.

  • Culture Conditions: Grow transformed cells in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8. Induce expression with 0.5 mM IPTG and continue growth at 18°C for 16-18 hours to maximize protein yield while minimizing inclusion body formation.

  • Cell Lysis: Harvest cells by centrifugation and disrupt using a cell disruptor in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors.

  • Membrane Fraction Isolation: Separate the membrane fraction by ultracentrifugation (100,000 × g, 1 hour).

  • Detergent Solubilization: Solubilize the membrane fraction using 1% n-dodecyl-β-D-maltopyranoside (DDM) or fos-choline-12 (FC12) detergent in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10% glycerol .

  • Affinity Purification: Purify the solubilized protein using Ni-NTA affinity chromatography with an imidazole gradient (20-300 mM).

  • Size Exclusion Chromatography: Further purify by size exclusion chromatography using a Superdex 200 column in buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol, and 0.03% DDM or FC12.

This protocol typically yields 1-3 mg of purified protein per liter of culture, with a purity exceeding 95% as assessed by SDS-PAGE. The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term storage .

What are the optimal conditions for cultivating Nostoc sp. to study native LspA expression?

Cultivating Nostoc sp. under optimized laboratory conditions is essential for studying native LspA expression. Based on recent research on Nostoc cultivation, the following parameters are recommended:

Table 2: Optimal Cultivation Conditions for Nostoc sp.

ParameterOptimal ConditionNotes
Growth MediumModified BG11 (mBG11)Provides best growth rates compared to other media formulations
Initial Biomass Concentration0.2-0.5 g/LLower initial concentrations promote faster growth rates
Temperature25-28°CMaintains optimal metabolic activity
Light Intensity50-100 μmol photons m^-2 s^-1PAR (Photosynthetically Active Radiation) range
Light Cycle16:8 (light:dark)Mimics natural conditions while maximizing growth
pH7.5-8.0Maintained with 10 mM HEPES buffer
Nitrogen SourceCombined sourcesBoth nitrate and ammonium can enhance growth
Culture Duration15+ daysGrowth curve typically reaches exponential phase after 12-15 days

For experimental analysis of native LspA expression, harvest cells during mid-to-late exponential phase (around day 12-15) when protein expression is typically highest. Monitor growth via optical density measurements at 750 nm and calculate specific growth rate (SGR) to determine optimal harvest time .

To enhance biomass productivity, supplement the medium with additional nitrogen sources, as nitrogen availability has been shown to significantly affect Nostoc growth and protein expression . For studying the relationship between nitrogen fixation and LspA expression, consider comparing cultures grown with and without combined nitrogen to observe potential differential expression patterns.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of Nostoc sp. LspA?

Site-directed mutagenesis represents a powerful approach for dissecting the catalytic mechanism of Nostoc sp. LspA. Based on the high conservation of active site residues across bacterial species, the following strategic mutagenesis framework is recommended:

  • Catalytic Dyad Mutations: Target the presumed catalytic aspartate residues for mutation to asparagine or alanine. This will disrupt the aspartyl protease activity while maintaining similar steric properties, allowing assessment of their direct role in catalysis .

  • Conserved Residue Analysis: Systematically mutate the 14 highly conserved residues surrounding the active site. Create a panel of conservative and non-conservative substitutions to evaluate their contributions to substrate binding, catalysis, and structural integrity .

  • Periplasmic Helix Flexibility Modulation: Introduce mutations that would either increase or decrease the flexibility of the periplasmic helix to test the hypothesis that its dynamic movement is essential for substrate binding and product release. Proline insertions can restrict conformational freedom, while glycine substitutions can enhance flexibility .

  • Substrate Specificity Determinants: Create chimeric constructs combining regions from Nostoc sp. LspA with those from other bacterial LspA proteins to identify domains responsible for potential substrate specificity differences.

Each mutant should be characterized through a comprehensive functional and structural analysis pipeline:

  • Enzymatic activity assays using synthetic peptide substrates

  • Thermal stability measurements to assess structural integrity

  • Binding affinity determinations for globomycin and substrate analogs

  • EPR spectroscopy to analyze changes in conformational dynamics

  • Molecular dynamics simulations to predict and interpret experimental findings

This systematic mutagenesis approach will provide insights into residues essential for catalysis versus those involved in substrate binding or conformational changes, ultimately elucidating the complete catalytic cycle of Nostoc sp. LspA and potentially revealing species-specific adaptations.

What are the challenges in crystallizing LspA and strategies to overcome them?

Crystallizing membrane proteins like LspA presents significant challenges due to their hydrophobic nature and conformational heterogeneity. The crystal structures of LspA have only been determined in complex with antibiotics like globomycin, while apo and substrate-bound structures remain elusive . Researchers face several specific challenges:

Table 3: Challenges and Solutions for LspA Crystallization

ChallengeDescriptionStrategic Solutions
Conformational HeterogeneityLspA exists in multiple conformational states in dynamic equilibrium Use of conformation-specific antibodies or nanobodies to lock specific states; employ disulfide engineering to restrict conformational sampling
Detergent SelectionDetergent micelles can interfere with crystal contactsScreen diverse detergents beyond FC12; test novel amphipols and nanodiscs; explore lipidic cubic phase crystallization
Low Expression YieldsMembrane proteins typically express at lower levelsOptimize expression using specialized strains (C43/C41); consider fusion partners like T4 lysozyme; explore eukaryotic expression systems for higher yields
Protein StabilityConformational instability can impede crystallizationAdd stabilizing ligands during purification; use thermostabilizing mutations; consider directed evolution approaches for stability enhancement
Crystal PackingDifficulty forming stable crystal lattice contactsEngineer additional soluble domains to promote crystal contacts; use antibody fragments to expand polar surface area

A particularly promising approach combines conformational stabilization through globomycin binding (which has previously yielded crystals) with targeted mutations that enhance stability of specific conformations. Consider introducing pairs of cysteines at positions identified by MD simulations and EPR studies to form disulfide bonds that lock the protein in specific conformational states .

Additionally, lipidic cubic phase (LCP) crystallization may prove advantageous for Nostoc sp. LspA, as this method provides a membrane-like environment that can better maintain native protein structure. Implementing these strategies systematically through a comprehensive crystallization screening pipeline will increase the likelihood of obtaining diffraction-quality crystals of Nostoc sp. LspA in apo and substrate-bound forms.

How does Nostoc sp. LspA function relate to the organism's nitrogen fixation capabilities?

The relationship between Nostoc sp. LspA and nitrogen fixation represents an intriguing yet underexplored research area. While direct experimental evidence linking these systems is limited, several functional connections can be hypothesized based on current knowledge:

Nostoc sp. is known for its nitrogen fixation capabilities, converting atmospheric nitrogen (N₂) into ammonia (NH₃) through specialized structures called heterocysts . This process requires extensive membrane remodeling and the coordinated expression of numerous membrane-associated proteins. As LspA processes lipoproteins that are destined for membrane localization, it likely plays an indirect but significant role in nitrogen fixation through several potential mechanisms:

  • Heterocyst Development: Heterocyst formation involves extensive membrane reorganization and differential protein expression. LspA may process specific lipoproteins required for heterocyst envelope formation or function.

  • Nitrogenase Protection: The nitrogenase enzyme complex responsible for nitrogen fixation is oxygen-sensitive. Certain membrane lipoproteins processed by LspA might contribute to maintaining the microaerobic environment required for nitrogenase activity.

  • Nutrient Transport: Nitrogen fixation is an energy-intensive process requiring efficient nutrient acquisition systems. LspA-processed lipoproteins may include transporters or signaling proteins that coordinate nitrogen fixation with cellular metabolism.

  • Signaling Integration: Environmental sensing and response coordination are essential for triggering nitrogen fixation. LspA may process lipoproteins involved in signaling cascades that regulate the nitrogen fixation response.

The experimental investigation of these hypotheses would require comparative proteomic analysis of wild-type Nostoc sp. versus LspA-depleted strains under nitrogen-fixing conditions. Identifying lipoproteins whose membrane localization is affected by LspA depletion, and correlating these changes with nitrogen fixation efficiency, would provide valuable insights into this functional relationship.

What are the key methodological differences when working with LspA from different bacterial sources?

Working with LspA from different bacterial sources presents distinct methodological challenges due to variations in expression systems, membrane composition, and biochemical properties. Researchers should consider the following key differences when adapting protocols for Nostoc sp. LspA versus other bacterial sources:

Table 4: Methodological Considerations for LspA from Different Sources

ParameterGram-negative Bacteria (e.g., P. aeruginosa)Gram-positive Bacteria (e.g., S. aureus)Cyanobacteria (e.g., Nostoc sp.)
Membrane ExtractionOuter and inner membranes require separationSingle membrane, thicker peptidoglycan layerThylakoid and plasma membranes present unique challenges
Detergent SelectionDDM or FC12 typically effective Stronger detergents often requiredRequires careful optimization to preserve activity amid photosynthetic complexes
Expression SystemsE. coli C43(DE3) effective Codon optimization often necessaryMay require specialized expression systems with cyanobacterial chaperones
Purification TemperatureStandard 4°C protocolsSimilar to Gram-negativeShould be performed under dim light conditions to prevent photoxidation
Activity AssaysStandard fluorogenic peptide substratesSimilar substrates applicableMay require adjustments for pH optimum and salt tolerance
Stability ConsiderationsGenerally stable in standard buffersOften more stable in higher saltMay have light sensitivity; requires antioxidants in buffers

When working specifically with Nostoc sp. LspA, researchers should pay particular attention to:

  • Light Protection: Conducting purification under dim light conditions to prevent potential photooxidative damage from photosensitizers present in cyanobacterial membranes.

  • Membrane Fractionation: Implementing specialized protocols to separate thylakoid membranes from plasma membranes if targeting LspA from specific membrane fractions.

  • Buffer Composition: Including cyanobacteria-specific considerations such as added glycerol (50%) for stability and optimized salt concentrations that reflect the native environment .

  • Chaperone Co-expression: When expressing recombinant Nostoc sp. LspA, consider co-expressing cyanobacterial-specific chaperones to enhance proper folding.

These methodological adaptations are essential for successful work with Nostoc sp. LspA and highlight the importance of source-specific optimization when working with homologous proteins from diverse bacterial origins.

What are the major technical challenges in studying recombinant Nostoc sp. LspA?

Despite recent advances, several significant technical challenges persist in the study of recombinant Nostoc sp. LspA that require innovative approaches:

Addressing these challenges requires interdisciplinary approaches combining biochemical, biophysical, and genetic techniques, potentially yielding insights not only into LspA biology but also into broader aspects of cyanobacterial membrane protein processing and function.

How might inhibitor development for Nostoc sp. LspA inform antibiotic research?

While commercial applications fall outside the scope of academic research focus, the fundamental study of Nostoc sp. LspA inhibition mechanisms offers valuable insights for antibiotic research paradigms. Cyanobacterial LspA serves as an excellent model system for several reasons:

  • Evolutionary Conservation with Divergence: Nostoc sp. LspA maintains the core catalytic machinery of bacterial LspA while exhibiting sequence divergence in other regions. Comparative inhibition studies between pathogenic bacterial LspA and Nostoc sp. LspA can reveal which structural elements are most promising for selective targeting.

  • Conformational Dynamics Insights: The study of how inhibitors like globomycin alter the conformational equilibrium of Nostoc sp. LspA provides fundamental mechanistic understanding. The finding that globomycin stabilizes an intermediate conformation that prevents both substrate binding and catalysis offers a conceptual framework for rational inhibitor design .

  • Resistance Mechanism Exploration: Non-pathogenic Nostoc provides a safe experimental system for studying potential resistance mechanisms. By applying evolutionary pressure through continuous culture with sub-lethal inhibitor concentrations, researchers can identify and characterize resistance mutations that might emerge in pathogenic bacteria.

  • Structure-Function Relationships: Systematic mutagenesis of Nostoc sp. LspA coupled with inhibition studies can map the contribution of individual residues to inhibitor binding without biosafety concerns associated with pathogenic species.

  • Novel Binding Modes: The distinct evolutionary history of cyanobacterial LspA might reveal alternative inhibitor binding sites not present or accessible in pathogenic bacterial enzymes, potentially inspiring new classes of inhibitory compounds.

These fundamental studies contribute to the broader understanding of membrane protease inhibition mechanisms and provide valuable insights for researchers developing new antimicrobial strategies, without directly engaging in applied pharmaceutical development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.