Recombinant Nostoc sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant YidC from Nostoc sp. is produced via heterologous expression systems, retaining the core structural and functional features of native YidC:

  • UniProt ID: Q8YRM9

  • Gene Locus: alr3415

  • Amino Acid Sequence: Comprises 380 residues, including a conserved five-transmembrane (TM) domain core and cytoplasmic loops critical for ribosome interaction .

  • Post-Translational Modifications: Contains a production-dependent tag (unspecified in public data) to aid purification .

Key Mechanisms:

  • Hydrophilic Groove: Binds substrate proteins via residues like R72, enabling guided insertion into the lipid bilayer .

  • Lipid Accessibility: Facilitates substrate integration at the protein-lipid interface, as observed in cryo-EM studies .

Biotechnological Applications

Recombinant Nostoc YidC is commercially available for research applications:

ParameterSpecificationSource
Expression SystemE. coli (optimized for soluble expression)
Purity>90% (SDS-PAGE verified)
StorageTris buffer, 50% glycerol; -20°C/-80°C
ApplicationsELISA, membrane protein insertion assays

4.1. Substrate Specificity

  • Sec-Independent Substrates: Pf3 coat protein, MscL, and F0c subunit utilize YidC’s hydrophilic groove for insertion .

  • Sec-Dependent Synergy: Collaborates with SecYEG for multi-pass transmembrane proteins (e.g., respiratory complexes) .

4.2. Evolutionary Conservation

  • Homologs: Mitochondrial Oxa1 and chloroplast Alb3 share structural and functional homology with YidC, underscoring evolutionary conservation .

  • Nostoc-Specific Adaptations: While Nostoc YidC’s mechanism aligns with bacterial homologs, its role in extremophile membrane stability remains underexplored .

Knowledge Gaps and Future Directions

  • Structural Dynamics: High-resolution structures of Nostoc YidC-substrate complexes are lacking, unlike E. coli YidC .

  • Environmental Adaptations: Potential links between YidC and desiccation tolerance in Nostoc warrant investigation, given the genus’s resilience .

  • Interactome Studies: YidC’s partnership with regulators like YibN (enhancing insertion efficiency 1.5–1.8× in vitro) remains unverified in Nostoc .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for precise delivery time.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing it.
Synonyms
yidC; alr3415; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
yidC
Target Protein Sequence
MDFGIGFLSNNVMLPIIDFFYSVVPSYGLAIVALTLIIRFALYPLSAGQIRNMRKMRIVQ PLMQKRMAEIKERYKDDPQKQQEEMMNVQKEFGNPLAGCLPLLLQMPVLLALFATLRGSP FAGVNYSVNLQIFPSEQIERIQPQAFATPPQNIYIADGEHTKVTAILPGGNKLAVGEKTK IQYQTLEGKPFPVLLAEHPESKLSPEWKITKGEDRIKIDAEGNIEALQPGDVTIQGTIPG LAADKGFLFIDALGRVGAIDPDNTIHWDIVGMIVFFGISLYVSQMLSGQNSSGGNPQQDT VNKITPVIFSGMFLFFPLPAGVLMYMVIGNVFQTLQTYILSREPLPEEIQKIVETQEKQA VAEQKTLPFEPKSSKKKTTG
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integrating membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates the folding of multispanning membrane proteins. It likely also assists in protein insertion, folding and/or assembly of membrane complexes destined for the thylakoid.
Database Links

KEGG: ana:alr3415

STRING: 103690.alr3415

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Intermediate Research Questions

  • What methods are commonly used to express and purify recombinant YidC from Nostoc sp.?

Recombinant Nostoc sp. YidC can be produced using established protocols:

  • Expression System: E. coli BL21(DE3) is typically used for protein expression, as noted in search result .

  • Tagging Strategy: N-terminal His-tagging is commonly employed for purification purposes. The recombinant protein is typically expressed as a fusion protein with a His-tag at the N-terminus .

  • Purification Method: Affinity chromatography utilizing the His-tag is the primary purification approach, followed by additional chromatography steps if higher purity is required.

  • Storage Conditions: The purified protein is often stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, aliquoting with 50% glycerol and storage at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles .

After purification, the protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL for experimental use .

  • How does YidC interact with the Sec translocase system in membrane protein insertion?

YidC cooperates with the Sec translocase system through specific molecular interactions:

  • Sequential Interaction: YidC has an early role in receiving and recognizing transmembrane segments at a stage when the translating ribosome is in close proximity to the Sec translocon .

  • Co-translational Insertion: YidC assists in docking ribosomes that synthesize integral membrane proteins (IMPs) to facilitate co-translational insertion .

  • Binding Affinity: Fluorescence resonance energy transfer (FRET) experiments have determined that YidC binds to SecYEG with a Kd of 27 (± 10) nM, indicating a strong interaction .

  • Interaction Methodology: This interaction can be studied by labeling YidC with Atto520 at position W23C and SecYEG with Atto647N at position M142C, where energy transfer occurs at a maximum when SecYEG and YidC reach a 1:1 molar ratio .

These findings suggest that YidC works in concert with the Sec translocase to ensure proper insertion and folding of membrane proteins with complex topologies.

  • What is the ecological significance of Nostoc sp. and how does YidC contribute to its environmental adaptability?

Nostoc sp. is an ecologically important cyanobacterium with remarkable environmental adaptability:

  • Habitat Diversity: Nostoc can proliferate in almost any environment, including polar, tropical, aquatic, and terrestrial ecosystems .

  • Desiccation Tolerance: Nostoc colonies can completely desiccate in dry conditions and then rehydrate when moisture returns, making them highly resilient to changing environmental conditions .

  • Nitrogen Fixation: In heterocyst cells, Nostoc fixes atmospheric nitrogen, contributing to soil fertility and ecosystem productivity .

  • Symbiotic Relationships: Some Nostoc species form symbiotic relationships with plants like cycads and angiosperms such as Gunnera, as well as non-vascular plants and lichen-forming fungi .

YidC contributes to this adaptability by ensuring proper insertion of membrane proteins involved in photosynthesis, nitrogen fixation, and stress response. The protein's role in assembling these critical membrane complexes is essential for Nostoc's survival under diverse and challenging environmental conditions .

Advanced Research Questions

  • How does the structure of YidC contribute to its function in membrane protein insertion?

The structural elements of YidC play specific roles in its insertase function:

  • Transmembrane Helices: MD simulations reveal that the five TM helices form a rigid protein core, while polar loop regions interact with the membrane surface .

  • Hydrophobic Slide: The hydrophobic slide, consisting primarily of TM3 and TM5, contacts the hydrophobic segments of substrate proteins during insertion .

  • Critical Residues: Certain residues are essential for YidC function. Alanine mutations of T362 in TM2 and Y517 in TM6 completely inactivate YidC, while mutations of residues F433, M471, and F505 result in intermediate activity levels .

  • Core Stabilization: The YidC core is stabilized by:

    • Hydrophobic residues on the exterior of the TM bundle that interact with lipid tails

    • Polar/charged residues on the cytoplasmic side engaged in electrostatic interactions

    • Aromatic residues on the periplasmic side involved in stacking and nonpolar dispersion interactions

This structural arrangement creates a protected environment that facilitates the insertion of membrane proteins into the lipid bilayer.

  • What methodologies are most effective for studying YidC-mediated membrane insertion mechanisms?

Several sophisticated methodologies have proven effective for investigating YidC function:

MethodologyApplicationKey Findings
Molecular Dynamics (MD) SimulationsStructure-function analysisRevealed that the five TM helices form a rigid core while polar loop regions interact with the membrane surface
Covariation AnalysisStructural modelingIdentified helix-helix contacts with probabilities above 57%, helping to position the five TM helices relative to each other
Site-Directed MutagenesisFunctional analysisIdentified critical residues such as T362 and Y517 that are essential for YidC function
FRET AnalysisProtein-protein interactionsDetermined a binding affinity of 27 (± 10) nM between YidC and SecYEG
Targeted Molecular Dynamics (TMD)Insertion mechanism studiesElucidated the insertion process of substrate proteins like Pf3 Coat
Proteomic AnalysisProtein expression studiesIdentified changes in protein expression under conditions like BMAA treatment

Combining these approaches provides a comprehensive understanding of YidC's structure, function, and interactions in membrane protein biogenesis.

  • How does deletion of specific domains affect YidC function and dynamics?

Domain deletion studies have revealed the functional significance of specific YidC regions:

A study examining four YidC variants demonstrated significant structural and functional differences:

  • Wild-type YidC: Complete structure with periplasmic domain (PD) and cytoplasmic C2 loop

  • YidC ΔC2: YidC without the C2 loop

  • YidC ΔPD: YidC without the periplasmic domain

  • YidC ΔPD ΔC2: YidC without both the periplasmic domain and C2 loop

Principal component analysis (PCA) of these variants revealed that:

  • PC1 contributed 27.5% of the total variance

  • PC2 contributed 19.1% of the total variance

  • The YidC ΔPD ΔC2 variant showed dramatically different behavior compared to other variants

These findings confirm that the C2 loop plays a crucial role in the conformational dynamics of YidC. Inter-helical angle analysis further demonstrated that deleting these domains affected the arrangement of the transmembrane helices, which are essential for substrate recognition and insertion .

  • How does β-N-Methylamino-L-Alanine (BMAA) affect YidC expression and function in Nostoc sp.?

BMAA, a non-proteinogenic amino acid, has significant effects on protein expression in Nostoc sp. PCC 7120:

  • Proteomic Analysis: A comprehensive study identified 1,567 different proteins in Nostoc sp. PCC 7120 cells under BMAA treatment in diazotrophic conditions .

  • YidC Expression: BMAA treatment resulted in significant downregulation of YidC (alr3415), with a fold change of 0.81 (p=0.0105) .

  • Nitrogen Fixation Impact: BMAA treatment led to strong downregulation (up to 80%) of nitrogenase components NifD and NifK .

  • Membrane Protein Assembly: The decreased expression of YidC likely affects the assembly of multiple membrane proteins, including those involved in photosynthesis and nitrogen fixation .

This research suggests that environmental or metabolic stressors that affect YidC expression could have widespread consequences for membrane protein biogenesis and cellular function in cyanobacteria.

  • What is the role of YidC in the biogenesis of photosynthetic complexes in cyanobacteria?

YidC plays a crucial role in photosynthetic complex assembly in cyanobacteria:

  • Photosystem II Biogenesis: YidC is required for the synthesis and assembly of photosystem II proteins. When YidC is degraded (as occurs with accumulation of type IV prepilin), photosystem II protein synthesis is inhibited .

  • Energy Generation: YidC contributes to the assembly of the F₀F₁-ATPase and cytochrome o oxidase, which are essential for energy generation. Loss of YidC leads to rapid defects in the functional assembly of these complexes .

  • Desiccation Tolerance: In Nostoc species adapted to subaerial habitats, YidC-mediated insertion of specific proteins contributes to desiccation tolerance mechanisms that protect photosynthetic apparatus during dry periods .

  • Relationship with Hlips: YidC likely participates in the insertion of high light-inducible proteins (Hlips), which play a crucial role in photoprotection and photosystem II repair in desiccation-tolerant cyanobacteria like Nostoc .

Understanding YidC's role in photosynthetic complex assembly is particularly important for research on bioenergy production and stress responses in photosynthetic organisms.

  • What are the current challenges and future directions in YidC research?

Several significant challenges and promising research directions exist in the field:

  • Substrate Specificity: Further research is needed to fully understand what determines which membrane proteins require YidC for insertion and how substrate specificity is achieved.

  • Real-time Dynamics: Developing methods to observe YidC-mediated insertion in real-time remains challenging but would provide valuable insights into the insertion mechanism.

  • Interaction Networks: Only a few model integral membrane proteins (IMPs) have been used in YidC studies. More information is necessary to fully assess YidC's functions in inserting and assembling Sec-dependent IMPs of different complexity and topology .

  • Therapeutic Applications: Understanding the structural and functional differences between bacterial YidC and its human mitochondrial homologue Oxa1 could potentially lead to the development of novel antibiotics that specifically target bacterial membrane protein biogenesis.

  • Synthetic Biology Applications: Engineered YidC variants could potentially be developed for improved membrane protein production in biotechnology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.