Recombinant Nostoc sp. NAD (P)H-quinone oxidoreductase chain 6 (ndhG)

Shipped with Ice Packs
In Stock

Description

Functional Role

NDH-G functions as part of the NDH-1 complex, which:

  • Shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur clusters, contributing to proton gradient formation .

  • Supports cyclic electron transport in photosynthesis, enhancing ATP synthesis under stress conditions .

  • Potentially participates in a chloroplast respiratory chain, though this role is less characterized in cyanobacteria .

Biochemical Activity

  • Recombinant ndhG retains quinone reductase activity, critical for mitigating oxidative stress by reducing quinones to hydroquinones .

  • The enzyme’s interaction with FMN and Fe-S centers aligns with mechanisms observed in other NAD(P)H:quinone oxidoreductases, such as azoreductases .

Evolutionary Context

  • ndhG belongs to a flavoprotein superfamily that includes azoreductases and type II NAD(P)H dehydrogenases, suggesting conserved catalytic mechanisms across species .

  • Phylogenetic analysis highlights divergence between bacterial NDH-1 subunits and mitochondrial Complex I homologs .

Applications and Implications

  • Biotechnological tool: Used in ELISA and structural studies to probe NDH-1 complex dynamics .

  • Bioenergy research: Insights into electron transport efficiency could inform engineered photosynthetic systems .

  • Antioxidant studies: Potential applications in mitigating ROS generation in industrial microbes .

Limitations and Future Directions

Current knowledge gaps include:

  • Structural resolution: No high-resolution crystal structure of Nostoc ndhG is available, limiting mechanistic insights .

  • Physiological context: The exact role of NDH-1 in cyanobacterial respiration remains debated .

Future studies could leverage recombinant ndhG to explore its interactions with other NDH subunits or its response to environmental stressors.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please clearly specify your preferred format when placing your order, and we will prepare accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For best results, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We determine the tag type during the production process. If you require a specific tag type, please communicate your preference and we will prioritize its development accordingly.
Synonyms
ndhG; alr0225; NAD(PH-quinone oxidoreductase chain 6; NAD(PH dehydrogenase I, chain 6; NDH-1, chain 6; NDH-G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
ndhG
Target Protein Sequence
MNLAEGVQVVSFGILATMLIGTALGVVLATSIVYSAFLLGGVFISIAGMYLLLNGDFVAA AQVLVYVGAVNVLILFAIMLVNKRQDFTPYPSAGIRKVLTAIVSVGLFALLSTMVLATPW AYSTTPKVGDGSIIVIGEHFFSDFLLPFELASVLLLMAMVGAIILARREYLPEVTPSGLP QTVLTLPERPRELVGAGSETQE
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NAD(P)H, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. The enzyme couples the redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links

KEGG: ana:alr0225

STRING: 103690.alr0225

Protein Families
Complex I subunit 6 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase chain 6 (ndhG) in Nostoc sp., and what cellular functions does it serve?

NAD(P)H-quinone oxidoreductase chain 6 (ndhG) is a protein component of the NAD(P)H dehydrogenase I complex in Nostoc sp. (strain PCC 7120 / UTEX 2576). As part of the NDH-1 complex, it plays a critical role in electron transport processes within the cyanobacterial cell. The protein functions with EC classification 1.6.5.- and is encoded by the ndhG gene (alr0225 locus) .

Methodologically, researchers investigating this protein's function typically use comparative genomics, biochemical assays focusing on electron transport activity, and structural analysis techniques. The protein's role in bioenergetics involves transferring electrons from NAD(P)H to quinones within the respiratory and/or photosynthetic electron transport chains, making it essential for energy metabolism in Nostoc sp.

What optimal storage conditions should be maintained for recombinant ndhG to preserve activity?

To maintain optimal activity of recombinant ndhG protein, store the protein in Tris-based buffer with 50% glycerol at -20°C for routine storage. For long-term storage, maintain at -20°C or -80°C .

Methodologically, researchers should:

  • Avoid repeated freeze-thaw cycles, which significantly degrade protein integrity

  • Prepare working aliquots that can be stored at 4°C for up to one week

  • Monitor protein stability via activity assays before experimental use

  • Consider addition of reducing agents (e.g., DTT or β-mercaptoethanol) at 1-5 mM if oxidation is a concern

  • Perform quality control tests after extended storage periods to confirm retention of biochemical properties

What is the optimal nutrient medium composition for maximizing Nostoc sp. growth in laboratory conditions?

Research indicates that modified BG11 (mBG11) medium significantly outperforms commercial alternatives for Nostoc sp. cultivation. Comparative studies demonstrated that Nostoc sp. exhibited a specific growth rate of 0.149 ± 0.0237 μ.day−1 in mBG11, compared to 0.101 ± 0.009 μ.day−1 in Nutribloom and just 0.010 ± 0.0229 μ.day−1 in FloraNova .

The standard composition of mBG11 medium includes:

ComponentConcentration
NaNO₃1.5 g/L
K₂HPO₄0.04 g/L
MgSO₄·7H₂O0.075 g/L
CaCl₂·2H₂O0.036 g/L
Citric acid0.006 g/L
Ferric ammonium citrate0.006 g/L
EDTA0.001 g/L
Na₂CO₃0.02 g/L
Trace metal mix A51 mL/L

For optimal expression of ndhG, nitrogen levels are particularly important as they influence protein synthesis pathways. Additionally, trace elements, particularly iron, are crucial as they are involved in electron transport chain functionality .

How does initial biomass concentration affect growth rate and productivity of Nostoc sp. cultures?

Initial biomass concentration significantly impacts the growth kinetics of Nostoc sp. cultures. Experimental data shows that lower initial biomass concentrations (approximately 1 g·L−1) result in significantly higher specific growth rates (0.222 ± 0.018 μ·day−1) compared to higher initial concentrations .

A comparative analysis of different initial biomass concentrations reveals:

Initial Biomass Concentration (g·L−1)Specific Growth Rate (μ·day−1)Productivity (g·L−1·day−1)
1.00.222 ± 0.018~1.5*
3.7Lower than 1.0 g·L−12.195 ± 0.847
>3.7LowestSimilar to 3.7 g·L−1
*Estimated from growth rate data

Methodologically, researchers should establish baseline growth curves using different initial inoculum concentrations for their specific Nostoc sp. strain. The optimal balance between growth rate and final productivity should be determined based on the research objectives. For studies focused on ndhG expression, lower initial concentrations may be advantageous as they promote more rapid cellular division and potentially higher protein expression rates .

What are the methodological approaches for resolving biomass heterogeneity issues in Nostoc sp. cultivation?

Nostoc sp. biomass heterogeneity poses significant challenges for quantitative growth assessment. Traditional optical density measurements are often unreliable for Nostoc sp. due to its filamentous growth pattern and tendency to form heterogeneous aggregates .

Recommended methodological approaches include:

  • Fresh weight and dry weight determinations: Centrifuge samples at standardized speeds (typically 4000-5000 g for 10-15 minutes), remove supernatant, and weigh the pellet (fresh weight). For dry weight, dry the pellet at 60-70°C until constant weight is achieved.

  • Standardized homogenization protocol: Prior to any measurements, homogenize cultures using gentle mechanical disruption (e.g., glass bead vortexing or low-power sonication) to break up aggregates without damaging cells.

  • Chlorophyll-a extraction: As an indirect biomass indicator, extract and measure chlorophyll-a using 90% methanol or acetone extraction followed by spectrophotometric measurement at 665 nm.

  • Microscopic cell counting: For specialized studies, direct counting of filaments or heterocysts using standardized counting chambers can provide additional data on culture composition.

  • Protein content determination: Total protein extraction and quantification can serve as a reliable proxy for active biomass.

Researchers should establish conversion factors between these different measurement techniques for their specific cultivation system to ensure consistent reporting of results .

What techniques are most effective for isolating and analyzing the ndhG gene from Nostoc sp.?

Effective isolation and analysis of the ndhG gene (alr0225) from Nostoc sp. requires specialized molecular techniques adapted to cyanobacterial genomics:

  • DNA extraction protocol: Use specialized extraction buffers containing higher concentrations of chelating agents (10-20 mM EDTA) and detergents to break down the complex cell envelope of Nostoc sp. Include additional polysaccharide removal steps (e.g., CTAB treatment) to eliminate contaminating carbohydrates that can inhibit downstream applications.

  • PCR amplification strategy: Design primers targeting the ndhG coding region (full length: 609 bp) with the following considerations:

    • Include 50-100 bp flanking regions for complete coverage

    • Account for GC-rich regions (use DMSO or specialized polymerases)

    • Consider codon optimization for the expression system if planning recombinant protein production

  • Sequencing verification: Perform bidirectional Sanger sequencing to confirm gene integrity, particularly focusing on regions encoding transmembrane domains that are critical for protein function.

  • Expression analysis: Quantitative RT-PCR using appropriate reference genes (typically rnpB or 16S rRNA for cyanobacteria) is recommended for transcript-level analysis. Normalize expression data to these internal controls for accurate quantification .

How can researchers optimize the heterologous expression of Nostoc sp. ndhG in common laboratory systems?

Optimizing heterologous expression of Nostoc sp. ndhG presents unique challenges due to its membrane-associated nature and cyanobacterial origin. A systematic approach includes:

  • Expression system selection:

    • For functional studies: E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • For structural studies: Insect cell systems (Sf9, High Five) often provide better folding and post-translational modifications

    • For in vivo studies: Consider cyanobacterial expression hosts like Synechocystis sp.

  • Codon optimization considerations:

    • Adjust codons to match the preferred codon usage of the expression host

    • Avoid rare codons, particularly in the N-terminal region which can impede translation initiation

    • Consider GC content adjustments while maintaining key structural motifs

  • Expression vector elements:

    • Include appropriate signal sequences for membrane targeting

    • Use regulatable promoters (e.g., T7, tet, araBAD) to control expression levels

    • Add affinity tags (His-tag, FLAG, etc.) positioned to minimize interference with transmembrane domains, typically at the N-terminus or in soluble loop regions

  • Expression conditions optimization:

    • Reduce induction temperature (16-20°C) to slow protein synthesis and improve folding

    • Include membrane-stabilizing additives (glycerol 5-10%)

    • Use specialized media formulations (e.g., Terrific Broth supplemented with trace elements)

    • Consider co-expression with chaperones specific for membrane protein folding

  • Purification strategy:

    • Use mild detergents (DDM, LMNG) for membrane protein extraction

    • Implement two-step purification using orthogonal techniques

    • Verify protein integrity via Western blotting before functional assays

How can researchers effectively conduct comparative analysis between wild-type and mutant ndhG to understand functional domains?

Advanced comparative analysis between wild-type and mutant ndhG requires multi-faceted approaches:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through multi-sequence alignment of ndhG homologues

    • Focus on transmembrane domains and regions interfacing with other subunits

    • Create systematic alanine-scanning mutants of charged residues in putative quinone-binding regions

    • Generate chimeric proteins with homologous sequences from related cyanobacteria to identify specificity determinants

  • Functional assay development:

    • Measure NADH/NADPH oxidation rates spectrophotometrically (λ = 340 nm)

    • Assess quinone reduction using artificial electron acceptors

    • Monitor electron transfer rates using oxygen consumption measurements

    • Develop reconstitution systems in liposomes to assess proton pumping capacity

  • Structural impact assessment:

    • Use circular dichroism to compare secondary structure profiles

    • Apply limited proteolysis to identify structural perturbations in mutants

    • Implement molecular dynamics simulations to predict stability changes

    • When possible, obtain structures of select mutants using cryo-EM

  • Physiological context evaluation:

    • Complement ndhG-deficient mutants with wild-type and mutant variants

    • Measure growth rates under photoheterotrophic and photoautotrophic conditions

    • Assess stress tolerance, particularly to high light and oxidative conditions

    • Monitor photosynthetic parameters using PAM fluorometry

What methodologies are recommended for investigating protein-protein interactions within the NDH-1 complex involving ndhG?

Investigating protein-protein interactions within the NDH-1 complex requires specialized techniques adapted for membrane protein complexes:

  • Co-immunoprecipitation optimization:

    • Use gentle detergents (digitonin 0.5-1% or DDM 0.02-0.05%) to maintain complex integrity

    • Employ crosslinking agents (DSP, formaldehyde) at optimized concentrations prior to solubilization

    • Implement epitope-tagged versions of ndhG (His, FLAG, Strep) for pulldown experiments

    • Validate interactions using reciprocal pulldowns with antibodies against other complex subunits

  • Advanced co-localization techniques:

    • Apply FRET (Förster Resonance Energy Transfer) using fluorescently tagged subunits

    • Utilize BRET (Bioluminescence Resonance Energy Transfer) which can be less disruptive than fluorescent tags

    • Implement split-GFP complementation to visualize interaction interfaces in vivo

    • Conduct super-resolution microscopy to map spatial organization of complex components

  • Interaction mapping strategies:

    • Implement hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify interaction surfaces

    • Use chemical crosslinking coupled with mass spectrometry (XL-MS) to determine proximity relationships

    • Apply surface plasmon resonance (SPR) with purified components to measure binding affinities

    • Develop bacterial two-hybrid systems adapted for membrane proteins to screen for interaction partners

  • Structural biology approaches:

    • Cryo-electron microscopy of intact complexes at varying resolution levels

    • Single-particle analysis to identify subcomplexes and assembly intermediates

    • Structural mass spectrometry to obtain low-resolution topological models

    • Integrative structural modeling combining multiple experimental data sources

How can researchers analyze data inconsistencies and contradictions in ndhG functional studies across different experimental conditions?

Analyzing data inconsistencies in ndhG functional studies requires systematic evaluation of experimental variables and methodological differences:

  • Systematic parameter assessment:

    • Create a comprehensive matrix of experimental conditions across published studies

    • Identify key variables: growth conditions, protein preparation methods, assay buffers, detergents used

    • Apply meta-analysis techniques to evaluate the impact of these parameters on functional outcomes

    • Develop standardized protocols to resolve contradictions through controlled comparison

  • Data normalization strategies:

    • Implement internal standards for activity measurements

    • Convert disparate units to a common reference framework

    • Establish activity ratios relative to wild-type protein measured under identical conditions

    • Utilize Bayesian statistical approaches to identify outliers and reconcile contradictory results

  • Methodological validation approach:

    • Conduct side-by-side testing of different assay methods on identical protein preparations

    • Systematically vary one experimental parameter at a time to isolate sources of variability

    • Establish minimum reporting standards for experimental conditions and methods

    • Develop round-robin testing protocols among collaborating laboratories

  • Computational reconciliation techniques:

    • Apply machine learning algorithms to identify patterns in experimental conditions that predict outcomes

    • Develop predictive models that account for key experimental variables

    • Utilize principal component analysis to identify the major sources of variation across studies

    • Implement ensemble approaches that integrate multiple data types into consensus models

What are the current NIH guidelines that researchers should follow when working with recombinant Nostoc sp. and ndhG?

Researchers working with recombinant Nostoc sp. and ndhG must adhere to the updated NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, effective September 30, 2024. Key considerations include:

  • Containment requirements:

    • Nostoc sp. is typically classified as a Risk Group 1 organism, requiring Biosafety Level 1 (BSL-1) containment

    • Recombinant work involving ndhG gene transfer generally falls under Section III-D-2 of the NIH Guidelines

    • Work must be approved by the Institutional Biosafety Committee (IBC) prior to initiation

    • Pay special attention to the updated helper systems terminology (replacing "helper viruses") in the guidelines when designing expression systems

  • Documentation requirements:

    • Maintain detailed records of the recombinant construction methods

    • Document risk assessment for the specific gene constructs and expression systems

    • Record containment procedures implemented for the research

    • Update protocols if any methodological changes are implemented

  • Reporting obligations:

    • Submit regular updates to the IBC on ongoing research

    • Report any adverse events or containment breaches immediately

    • Document any unexpected phenotypes or characteristics in recombinant organisms

    • Maintain communication with institutional biosafety officers

What methodological approaches are recommended for risk assessment when designing experiments with recombinant ndhG?

Thorough risk assessment for recombinant ndhG experiments should follow a structured methodology:

  • Agent characterization:

    • Evaluate the function of ndhG in electron transport processes

    • Assess whether overexpression could alter metabolic profiles or stress responses

    • Consider any potential toxicity of the protein or its metabolic products

    • Evaluate the potential for horizontal gene transfer in the experimental system

  • Structured risk matrix development:

    • Create a probability-impact matrix for potential hazards

    • Assess likelihood of containment breach based on experimental design

    • Evaluate consequences of exposure based on protein function

    • Document mitigation strategies for each identified risk

  • Containment strategy design:

    • Implement physical containment appropriate to the risk level (typically BSL-1)

    • Design experiments with biological containment where possible (e.g., auxotrophic strains)

    • Establish workflow controls to minimize aerosol generation

    • Develop inactivation protocols specific to the experimental system

  • Personnel training protocols:

    • Train staff on the specific hazards associated with the research

    • Document competency in containment procedures

    • Establish emergency response protocols for potential exposures

    • Conduct regular refresher training and updates on changing regulations

How should researchers approach genetic and genomic data management when conducting studies on Nostoc sp. ndhG?

Effective genetic and genomic data management for Nostoc sp. ndhG research requires adherence to current standards and best practices:

  • Data collection standardization:

    • Implement standardized formats for genetic and sequence data (FASTA, GenBank, etc.)

    • Utilize consistent annotation systems for genomic elements

    • Apply standard ontologies for functional characterization

    • Document methodological details including sequencing platforms, coverage, and analysis pipelines

  • Data storage and security protocols:

    • Establish secure storage systems with appropriate backup procedures

    • Implement access controls consistent with institutional policies

    • Encrypt sensitive data, particularly if human genetic material is used for comparison

    • Maintain separation between genetic data and identifying information when applicable

  • Data sharing considerations:

    • Deposit sequence data in appropriate public repositories (GenBank, UniProt)

    • Share methodological details sufficient for replication

    • Consider embargo periods consistent with publication and patent strategies

    • Document any restrictions on data use based on funding or institutional requirements

  • Long-term data management planning:

    • Develop data retention policies consistent with institutional and funding requirements

    • Establish protocols for data transfer when personnel change

    • Create metadata systems that facilitate future data reuse

    • Consider evolving standards and plan for data format migration

What emerging technologies show promise for advancing the understanding of ndhG function in cyanobacterial bioenergetics?

Several cutting-edge technologies show significant promise for advancing our understanding of ndhG function:

  • Advanced structural biology approaches:

    • Cryo-electron tomography to visualize NDH-1 complexes in their native membrane environment

    • Time-resolved X-ray free-electron laser (XFEL) crystallography to capture transient conformational states

    • Integrative structural biology combining multiple data sources (cryo-EM, crosslinking-MS, EPR)

    • In-cell NMR techniques adapted for membrane proteins to study dynamics in near-native conditions

  • Single-molecule techniques:

    • Single-molecule FRET to monitor conformational changes during electron transfer

    • High-speed atomic force microscopy to visualize structural dynamics in real-time

    • Patch-clamp fluorometry to correlate structural changes with functional outcomes

    • Optical tweezers to measure forces associated with conformational changes

  • Advanced genetic manipulation approaches:

    • CRISPR-Cas9 genome editing optimized for cyanobacteria

    • Optogenetic control of gene expression to enable temporal regulation

    • Multiplex genome engineering to systematically alter multiple components simultaneously

    • Site-specific incorporation of unnatural amino acids to probe specific residue functions

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Flux balance analysis to model electron flow through the NDH-1 complex

    • Agent-based modeling of bioenergetic processes at the cellular level

    • Machine learning approaches to identify patterns in complex datasets and generate testable hypotheses

How might researchers effectively investigate the relationship between ndhG function and environmental adaptation in Nostoc sp.?

Investigating the relationship between ndhG function and environmental adaptation requires multi-faceted approaches:

  • Comparative genomics strategy:

    • Analyze ndhG sequences across Nostoc strains from diverse environments

    • Identify correlations between sequence variations and habitat characteristics

    • Conduct selection analysis to identify residues under positive or purifying selection

    • Perform ancestral sequence reconstruction to trace evolutionary adaptations

  • Environmental simulation experiments:

    • Design controlled growth chambers simulating specific environmental conditions

    • Monitor ndhG expression and NDH-1 complex activity under varying light intensities

    • Assess performance under fluctuating temperature regimes relevant to natural habitats

    • Evaluate responses to nutrient limitation, particularly nitrogen and carbon sources

  • Field sampling and analysis protocols:

    • Collect Nostoc populations from diverse environments following standardized protocols

    • Perform in situ activity measurements where possible

    • Extract RNA for immediate expression analysis to capture environmental response patterns

    • Correlate ndhG expression patterns with measured environmental parameters

  • Phenotypic characterization matrix:

    • Develop standardized assays to measure physiological parameters across strains

    • Create fitness landscapes correlating ndhG sequence variants with functional outcomes

    • Implement competition experiments under defined environmental gradients

    • Utilize microcosm experiments to assess community interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.