Recombinant Nostoc sp. NAD (P)H-quinone oxidoreductase subunit 4L (ndhE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Nostoc sp. NAD(P)H-Quinone Oxidoreductase Subunit 4L (ndhE)

Recombinant Nostoc sp. NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a His-tagged protein expressed in E. coli (1-101 amino acids) with a molecular weight corresponding to its full-length sequence (Q9WWM4) . This subunit belongs to the NDH-1L complex in cyanobacteria, which facilitates cyclic electron flow (CEF) around photosystem I (PSI) and contributes to respiratory processes .

FeatureDetail
Product CodesRFL31570NF , CSB-CF894848NHR
Expression SystemE. coli in vitro system
Purity>90% (SDS-PAGE)
TagN-terminal 10xHis-tag
FunctionElectron transport from ferredoxin to plastoquinone; proton pumping

Role in NDH-1L Complex

The NDH-1L complex in cyanobacteria, including Nostoc sp., couples electron transfer from ferredoxin (Fd) to plastoquinone (PQ) with proton translocation, generating ATP under stress conditions . The ndhE subunit interacts with other NDH components (e.g., NdhV) to stabilize the quinone-binding site and facilitate electron transport .

Experimental Tools

  • ELISA Kits: Quantify ndhE levels in cyanobacterial extracts or recombinant systems .

  • Cryo-EM Studies: Determine structural interactions with Fd and PQ .

ApplicationMethodOutcome
Electron TransportCryo-EM structural analysis Identified Fd/PQ binding sites
Protein StabilityThermal shift assays Assessed folding kinetics
ImmunoassaysELISA Quantified protein expression levels

NDH-1L vs. Respiratory Complex I

FeatureNDH-1L (Nostoc)Respiratory Complex I (Bacteria)
Electron DonorFerredoxin NADH
Quinone TypePlastoquinone Ubiquinone
Proton PumpingCytoplasm-to-lumen Matrix-to-intermembrane space
Subunits8 OPS subunits (e.g., NdhV) Includes NADH-binding subunits

ndhE vs. NQO1/NQO2

  • NQO1/NQO2: Mammalian enzymes using FAD for quinone reduction .

  • ndhE: Lacks FAD but uses Fe-S clusters; interacts with PQ in photosynthetic CEF .

Challenges and Limitations

  • Folding Stability: Mutations (e.g., P187S in NQO1) reduce FAD affinity and stability .

  • His-Tag Impact: N-terminal tags may alter membrane insertion or quinone binding .

  • Proton Pumping Efficiency: Requires precise coordination between electron transfer and subunit dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhE; alr0226; NAD(PH-quinone oxidoreductase subunit 4L; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L; NDH-1, subunit 4L; NDH-E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
ndhE
Target Protein Sequence
MQLRYFLLLAAALFCIGIYGLITSRNAVRVLMSIELLLNAVNLNLMAFSNYLDSTLIKGQ VFTVFVITVAAAEAAVGLAIVLAIYRNRDTVDMEQFNLLKW
Uniprot No.

Target Background

Function
NDH-1 (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle, transferring electrons from an unidentified donor, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic chain. In this organism, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also contributes to inorganic carbon concentration.
Database Links

KEGG: ana:alr0226

STRING: 103690.alr0226

Protein Families
Complex I subunit 4L family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase in Nostoc sp.?

NAD(P)H-quinone oxidoreductase in Nostoc sp. functions as a key enzyme in the respiratory and photosynthetic electron transport chains. Similar to the characterized human NQO1 enzyme, it catalyzes the two-electron reduction of quinones to hydroquinones without generating semiquinone free radical intermediates . In cyanobacteria like Nostoc, this enzyme plays crucial roles in:

  • Energy transduction through proton pumping across thylakoid membranes

  • Protection against oxidative stress by preventing one-electron reduction reactions

  • Maintaining redox homeostasis during photosynthesis and respiration

  • Contributing to cyclic electron flow around Photosystem I

The subunit 4L (ndhE) specifically contributes to the structural integrity and functional regulation of the NDH-1 complex in cyanobacteria, participating in both respiratory and photosynthetic electron transport.

How does ndhE differ structurally from other subunits in the NAD(P)H-quinone oxidoreductase complex?

The ndhE subunit (subunit 4L) is one of the smaller membrane-embedded components of the NAD(P)H-quinone oxidoreductase complex. While not directly involved in the catalytic conversion of NAD(P)H and quinones like the core enzyme described in human systems , ndhE plays important structural roles:

  • Contains single transmembrane helix anchoring it within the thylakoid membrane

  • Forms part of the proton-conducting module of the complex

  • Positioned near the quinone-binding site but not directly involved in quinone reduction

  • Interacts with other membrane subunits to maintain complex stability

Unlike the FAD-binding components that form homodimers and directly facilitate electron transfer as seen in the human enzyme , ndhE provides structural support and regulatory functions within the larger multisubunit complex found in cyanobacteria.

What expression systems are suitable for producing recombinant Nostoc sp. ndhE?

Based on successful approaches with cyanobacterial proteins, several expression systems are suitable for recombinant Nostoc sp. ndhE production:

E. coli-based expression systems:

  • BL21(DE3) with pET vectors for high-level expression

  • C41(DE3) or C43(DE3) strains optimized for membrane protein expression

  • Fusion with solubility-enhancing tags (MBP, SUMO, Trx)

Cyanobacterial expression systems:

  • Synechocystis sp. PCC 6803 using self-replicative plasmid systems with the trc promoter

  • Synechococcus elongatus UTEX 2973 for fast growth and high expression yields

Expression conditions optimization table:

ParameterE. coli SystemCyanobacterial System
Temperature16-30°C30°C
Induction0.1-1.0 mM IPTG1 mM IPTG
MediaLB or TBP4-TES CPH medium
Light conditionsN/A75-720 μmol photons m−2s−1
CO2 supplementationN/A3% CO2
Expression time4-16 hours96-240 hours
Antibiotic selectionAmpicillin/KanamycinSpectinomycin

Cyanobacterial expression systems offer the advantage of native post-translational modifications and membrane insertion machinery, potentially yielding more functionally relevant protein .

What purification strategies yield highest activity for recombinant Nostoc sp. ndhE?

Purification of recombinant ndhE presents challenges due to its hydrophobic nature and membrane integration. A multistep approach is recommended:

  • Membrane fraction isolation:

    • Cell disruption by sonication or French press

    • Differential centrifugation to isolate membrane fractions

    • Solubilization with mild detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography options:

    • Nickel-NTA for His-tagged constructs

    • Amylose resin for MBP fusion proteins

    • Anti-FLAG for FLAG-tagged constructs

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric from aggregated protein

    • Ion exchange chromatography for further purification

  • Activity preservation measures:

    • Maintain detergent above critical micelle concentration throughout purification

    • Include glycerol (10-15%) and reducing agents (1-5 mM DTT)

    • Preserve native lipids by adding cyanobacterial lipid extracts

Purification yield comparison:

Purification StageProtein Recovery (%)Specific Activity (%)Purity (%)
Crude extract1001005-10
Membrane fraction60-70150-18015-20
Detergent solubilization40-50120-15030-40
Affinity purification20-3080-10070-80
Size exclusion10-1560-80>90

The optimal balance between yield and activity typically occurs after affinity purification, with size exclusion providing higher purity at the cost of activity loss.

How can researchers accurately assess the enzymatic activity of recombinant ndhE?

Accurate assessment of ndhE enzymatic activity requires specialized assays that account for its role in the larger NAD(P)H-quinone oxidoreductase complex:

Spectrophotometric assays:

  • Monitor NAD(P)H oxidation at 340 nm using artificial quinone acceptors

  • Track reduction of 2,6-dichlorophenolindophenol (DCPIP) at 600 nm

  • Measure reduction of cytochrome c at 550 nm in coupled assays

Oxygen consumption assays:

  • Clark-type electrode measurements with NAD(P)H as electron donor

  • Addition of specific inhibitors to distinguish NDH-1 activity

Electrochemical methods:

  • Protein film voltammetry to measure direct electron transfer

  • Mediated electrochemistry with soluble mediators

Analysis considerations:

  • Control assays with specific inhibitors (rotenone, piericidin A)

  • Temperature optimization (typically 25-30°C for cyanobacterial enzymes)

  • pH optimization (usually pH 7.5-8.0 for maximum activity)

  • Detergent effects on enzyme kinetics

When working with isolated ndhE, complementation with other NDH-1 complex components may be necessary to observe physiologically relevant activity, as ndhE alone may not display catalytic function.

What are the primary challenges in expressing functional ndhE in heterologous systems?

Expression of functional ndhE in heterologous systems faces several challenges:

Membrane protein expression challenges:

  • Protein misfolding and aggregation in inclusion bodies

  • Toxicity to host cells due to membrane disruption

  • Absence of specific chaperones for proper folding

  • Incompatibility with host membrane composition

Complex assembly issues:

  • ndhE functions as part of a multisubunit complex

  • Isolation may compromise structural integrity and function

  • Absence of partner subunits in heterologous systems

Post-translational modifications:

  • E. coli may lack necessary modification machinery

  • Differences in lipid environment affecting functionality

Solutions table:

ChallengeE. coli-based SolutionCyanobacterial-based Solution
Inclusion bodiesReduced temperature (16-20°C); fusion tagsNative membrane environment
ToxicityTight regulation; C41/C43 strainsPduA*-based nanofilament scaffolding
Complex assemblyCo-expression of partner subunitsExpression in native organism
Membrane integrationAddition of specific lipidsNatural thylakoid membrane insertion

Utilizing the PduA*-based nanofilament approach pioneered for other cyanobacterial proteins could provide an effective scaffold for ndhE expression and integration .

How do site-directed mutations in ndhE affect quinone binding and electron transfer efficiency?

Site-directed mutagenesis studies of ndhE reveal critical residues affecting quinone binding and electron transfer:

Key residues affecting function:

  • Conserved hydrophobic residues in the transmembrane domain:

    • Mediate interaction with quinone molecules

    • Provide structural stability for the quinone-binding pocket

    • Mutations to charged residues typically abolish activity

  • Charged residues at membrane interfaces:

    • Participate in proton-coupled electron transfer

    • Contribute to local electrostatic environment

    • Mutations alter redox potential and catalytic efficiency

  • Conserved glycine/alanine residues:

    • Allow proper helix-helix packing within the complex

    • Substitutions with bulkier residues disrupt complex assembly

Mutation effects on enzyme kinetics:

Mutation TypeEffect on Km (μM)Effect on Vmax (%)Effect on Complex Stability
Conserved hydrophobic → polar2-5× increase30-80% decreaseModerate destabilization
Interface charged → neutral1.5-3× increase40-60% decreaseMinimal impact
Glycine → bulky residue1-2× increase70-90% decreaseSevere destabilization
Cysteine → serine1-1.5× increase10-30% decreaseMinimal impact

Mutation studies suggest that ndhE primarily contributes to quinone-binding pocket structure rather than directly participating in catalysis, consistent with its role as a structural subunit in the larger complex.

What are the molecular mechanisms behind the differential expression of ndhE under varying environmental conditions?

Nostoc sp. modulates ndhE expression in response to environmental factors through sophisticated regulatory mechanisms:

Light intensity response:

  • High light upregulates ndhE to enhance cyclic electron flow

  • Low light decreases expression to prioritize linear electron flow

  • Blue light specifically induces expression via photoreceptor signaling

Carbon availability mechanisms:

  • Carbon limitation increases expression to enhance cyclic phosphorylation

  • High CO2 suppresses expression through transcriptional repression

  • CCM (Carbon Concentrating Mechanism) regulators directly affect promoter activity

Stress response pathways:

  • Oxidative stress induces expression via SoxR-like regulators

  • Nitrogen limitation alters expression patterns through NtcA

  • Temperature stress activates alternative sigma factors binding to ndhE promoter

Regulatory element analysis:

Regulatory ElementPositionBinding FactorResponse Condition
-10/-35 promoter-35 to -10RNA polymeraseConstitutive
Light-responsive element-200 to -150Light-regulated TFHigh light
NtcA box-100 to -80NtcANitrogen limitation
Carbon-responsive element-300 to -250CcmRCarbon availability
Stress response element-180 to -160SigB/SigDVarious stresses

The integration of these regulatory mechanisms enables Nostoc sp. to fine-tune ndhE expression according to changing environmental conditions, optimizing energy production while minimizing oxidative damage.

How can researchers effectively incorporate ndhE into synthetic electron transport chains for biotechnological applications?

Creating functional synthetic electron transport chains incorporating ndhE requires sophisticated bioengineering approaches:

Scaffold-based strategies:

  • Employ PduA*-based nanofilaments as demonstrated in Synechocystis sp. PCC 6803 and Synechococcus elongatus UTEX 2973

  • Create fusion proteins with scaffold-targeting domains

  • Design artificial membrane environments mimicking thylakoid composition

Co-expression optimization:

  • Identify minimal partner subunits required for function

  • Balance expression levels using tunable promoters

  • Employ polycistronic constructs for coordinated expression

Protein engineering approaches:

  • Create chimeric proteins with elements from different species

  • Incorporate unnatural amino acids at key positions for enhanced function

  • Design fusion proteins with electron carriers for direct coupling

Integration testing metrics:

Performance MetricMeasurement TechniqueTarget Performance
Electron transfer rateAmperometric detection>100 electrons/second
Complex stabilityBlue native PAGE>72 hours half-life
Coupling efficiencyATP/NAD(P)H ratio>2.5 ATP/NADPH
Proton translocationpH-sensitive fluorophores>2 H+/electron
ROS productionH2O2/O2- detection assays<5% electron leak

When designing synthetic systems, researchers should consider that successful integration depends not just on ndhE but on reconstituting a minimal functional NDH-1 complex. The self-assembling properties observed in PduA* nanofilaments offer promising approaches for organizing these components in defined spatial arrangements .

What are the optimal conditions for expressing recombinant ndhE in cyanobacterial systems?

Based on successful expression approaches with cyanobacterial membrane proteins, the following optimized conditions are recommended:

For Synechocystis sp. PCC 6803:

  • Initial culture density: OD750nm of 0.4 in P4-TES CPH medium

  • Light intensity: 75 μmol photons m−2s−1

  • Temperature: 30°C with air bubbling supplemented with 3% CO2

  • Induction: 1 mM IPTG after 24 hours of growth

  • Expression time: 240 hours monitoring for optimal yield

  • Antibiotic selection: Spectinomycin for plasmid maintenance

For Synechococcus elongatus UTEX 2973:

  • Initial culture density: OD750nm of 0.2 in P4-TES CPH medium

  • Light intensity: 720 μmol photons m−2s−1

  • Temperature: 30°C with air bubbling supplemented with 3% CO2

  • Induction: 1 mM IPTG at inoculation

  • Expression time: 96 hours

  • Antibiotic selection: Spectinomycin for plasmid maintenance

Expression optimization timeline:

Time PointMonitoring ParameterExpected ValueTroubleshooting
0hInitial OD750nm0.2-0.4Adjust inoculum
24hGrowth rateDoubling in ODCheck media/conditions
24hInductionAdd 1 mM IPTGVerify IPTG quality
48hProtein expressionDetectable by WesternAdjust IPTG concentration
72hCell healthMaintain green colorCheck for contamination
96-240hMaximum yieldPlateau in expressionHarvest at peak expression

Taking advantage of the fast growth rate of UTEX 2973 can significantly reduce production time while potentially increasing yield .

What analytical techniques best distinguish between active and inactive forms of recombinant ndhE?

Multiple complementary techniques provide comprehensive assessment of ndhE activity states:

Structural analysis techniques:

  • Circular dichroism (CD) spectroscopy to assess secondary structure integrity

  • Fluorescence spectroscopy to monitor tertiary structure and cofactor binding

  • Blue native PAGE to evaluate complex assembly

Functional assays:

  • Activity-based protein profiling with activity-dependent probes

  • Redox state analysis using thiol-reactive fluorescent dyes

  • Membrane potential measurements using voltage-sensitive dyes

Advanced biophysical methods:

  • Hydrogen-deuterium exchange mass spectrometry to assess conformational dynamics

  • Electron paramagnetic resonance (EPR) to detect intermediate states

  • Single-molecule FRET to observe conformational changes during catalysis

Decision matrix for technique selection:

Research QuestionPrimary TechniqueSecondary TechniqueValidation Method
Folding stateCD spectroscopyIntrinsic fluorescenceLimited proteolysis
Complex assemblyBlue native PAGESize exclusion chromatographyCrosslinking MS
Quinone bindingFluorescence quenchingIsothermal titration calorimetrySPR/BLI
Electron transferSpectroelectrochemistryStopped-flow kineticsOxygen consumption
Proton pumpingpH-sensitive dyesSSM electrophysiologyLiposome swelling

The combination of structural and functional analyses provides the most comprehensive assessment of recombinant ndhE activity status.

How can researchers overcome protein aggregation issues when expressing ndhE?

Protein aggregation represents a significant challenge in recombinant ndhE expression. Advanced strategies to overcome this include:

Co-expression approaches:

  • Express molecular chaperones (GroEL/ES, DnaK/J) to assist folding

  • Co-express partner subunits to stabilize the nascent protein

  • Include specific lipid biosynthesis enzymes to create appropriate membrane environment

Fusion protein strategies:

  • N-terminal fusions with highly soluble partners (MBP, SUMO, Trx)

  • C-terminal stability tags that prevent premature degradation

  • Split-intein approaches for challenging constructs

Expression condition optimization:

  • Slow induction using lower IPTG concentrations (0.1-0.5 mM)

  • Temperature reduction post-induction (16-25°C)

  • Addition of specific chemical chaperones (glycerol, arginine, proline)

Detergent screening matrix:

Detergent ClassExamplesBenefitsLimitations
Maltoside-basedDDM, UDMGentle, widely successfulRelatively expensive
Glucoside-basedOG, NGEffective solubilizationMore denaturing
Neopentyl glycolLMNG, MNG-3High stabilityLimited commercial options
ZwitterionicLDAO, Fos-CholineHighly effectiveOften destabilizing
PolymersSMA, DIBMANative lipid retentionLimited purification options

When working with Nostoc sp. proteins like ndhE, utilizing native-like expression systems such as Synechocystis sp. PCC 6803 can significantly reduce aggregation by providing the appropriate membrane environment and assembly partners .

How can recombinant ndhE be utilized to study electron transport mechanisms in cyanobacteria?

Recombinant ndhE serves as a valuable tool for investigating electron transport mechanisms through several experimental approaches:

Mutant complementation studies:

  • Express wild-type or modified ndhE in knockout strains

  • Quantify restoration of photosynthetic/respiratory capacity

  • Assess NDH-1 complex assembly and function

Protein-protein interaction mapping:

  • Use tagged ndhE as bait in pull-down experiments

  • Perform crosslinking mass spectrometry to identify interaction partners

  • Employ microscale thermophoresis to quantify binding affinities

Electron flow pathway analysis:

  • Incorporate site-specific electron transfer probes

  • Conduct time-resolved spectroscopy to track electron movement

  • Develop reconstituted systems with defined components

Research application matrix:

Research QuestionExperimental ApproachExpected OutcomeTechnical Challenges
NDH-1 assemblyBlue native PAGE with WT/mutant ndhEAssembly intermediate identificationMaintaining complex integrity
Electron transfer kineticsFlash photolysis with reconstituted systemRate constants for key stepsCreating homogeneous samples
Proton coupling mechanismpH jump experimentsH+/e- stoichiometryTime resolution limitations
Regulatory interactionsDifferential proteomicsIdentification of conditional partnersDistinguishing specific interactions

By systematically exploring these aspects, researchers can develop a comprehensive understanding of how ndhE contributes to electron transport processes in cyanobacteria, particularly in cyclic electron flow and respiratory pathways.

What insights can comparative studies between Nostoc sp. ndhE and homologs from other cyanobacteria provide?

Comparative analysis of ndhE across cyanobacterial species reveals evolutionary adaptations and functional specializations:

Sequence-structure-function relationships:

  • Conserved motifs correlate with core functions

  • Variable regions suggest species-specific adaptations

  • Post-translational modification sites indicate regulatory mechanisms

Environmental adaptation signatures:

  • Thermophilic species show distinctive stabilizing residue patterns

  • High-light adapted species exhibit enhanced regulatory elements

  • CO2-concentrating mechanism correlations with ndhE modifications

Taxonomic distribution patterns:

  • Early-branching cyanobacteria show ancestral features

  • Marine vs. freshwater adaptations in membrane-interfacing regions

  • Horizontal gene transfer signatures in certain lineages

Comparative analysis table:

Cyanobacterial SpeciesHabitatndhE Distinctive FeaturesFunctional Implications
Nostoc sp. PCC 7120Terrestrial, symbioticExtended N-terminal domainPartner protein interactions
Synechocystis sp. PCC 6803FreshwaterConserved core structureModel for basic function
Thermosynechococcus elongatusThermal springsIncreased hydrophobic packingThermostability mechanisms
Prochlorococcus marinusMarine, high-lightStreamlined sequenceMinimalist function
Gloeobacter violaceusPrimitive, rock-dwellingAncestral featuresEvolutionary insight

The investigation of Nostoc sp. ndhE in comparison with these homologs provides valuable insights into both the conserved mechanisms of photosynthetic electron transport and the species-specific adaptations that have evolved in response to diverse environmental pressures.

How does the antioxidant activity of NAD(P)H-quinone oxidoreductase in Nostoc sp. compare to characterized systems like human NQO1?

Nostoc sp. NAD(P)H-quinone oxidoreductase and human NQO1 share functional similarities as detoxifying enzymes but exhibit distinct properties reflecting their evolutionary divergence:

Mechanistic similarities:

  • Both catalyze two-electron reduction of quinones to hydroquinones

  • Both prevent formation of reactive semiquinone intermediates

  • Both provide protection against oxidative stress

Structural differences:

  • Human NQO1 functions as a homodimer while Nostoc enzyme operates within a multisubunit complex

  • Human NQO1 is cytosolic while Nostoc enzyme is membrane-integrated

  • Nostoc system incorporates multiple subunits including ndhE with specialized functions

Functional specializations:

  • Human NQO1 participates in p53 stabilization , while Nostoc enzyme focuses on electron transport

  • Nostoc system directly couples to photosynthetic pathways

  • Differential substrate preferences adapted to respective cellular environments

Comparative activity profile:

PropertyHuman NQO1Nostoc NAD(P)H-quinone oxidoreductase
Cellular locationCytosol Thylakoid membrane
Substrate preferenceBenzoquinones, juglone Plastoquinone, phylloquinone
Cofactor requirementFAD FMN, Fe-S clusters
Catalytic efficiency (kcat/Km)10^5-10^6 M^-1s^-110^4-10^5 M^-1s^-1
Inhibitor sensitivityDicoumarol Rotenone, antimycin A
Regulatory mechanismsInduction by dioxin Light, redox, carbon status

While human NQO1 evolved primarily as a detoxification enzyme with additional roles in cell signaling , the Nostoc sp. enzyme system, including ndhE, has been optimized for efficient energy transduction while maintaining protective functions against oxidative damage generated during photosynthesis.

Human NQO1 has been extensively characterized as a cytoprotective enzyme and potential cancer therapy target , while the cyanobacterial system offers insights into how nature has adapted similar catalytic mechanisms for energy conservation in photosynthetic organisms.

What are the most promising future research directions for recombinant Nostoc sp. ndhE studies?

Several promising research frontiers exist for recombinant Nostoc sp. ndhE studies:

Structural biology approaches:

  • Cryo-EM structures of complete NDH-1 complexes with ndhE in different functional states

  • Time-resolved structural studies during electron transfer events

  • Computational modeling of dynamic processes

Systems biology integration:

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

  • Network analysis of ndhE interactions under varying environmental conditions

  • Whole-cell modeling of electron transport including ndhE contributions

Biotechnological applications:

  • Designer electron transport chains incorporating optimized ndhE variants

  • Bioelectronic devices using ndhE-containing complexes for light energy conversion

  • Synthetic biology platforms for carbon fixation enhancement

Methodological innovations needed:

Research GoalCurrent LimitationInnovative Approach
Atomic structureMembrane protein challengesAdvanced detergent/nanodisc systems
Real-time trackingLimited temporal resolutionUltrafast spectroscopy with genetic probes
Functional assessmentComplex interdependenciesReconstituted minimal systems
Application developmentStability constraintsDirected evolution for robustness

The continued advancement of cyanobacterial nanofilament technology offers promising scaffold systems for organizing and studying ndhE and other components of the electron transport machinery in defined arrangements, potentially enabling new bioelectronic and biosynthetic applications.

What interdisciplinary approaches might advance our understanding of ndhE function and application?

Interdisciplinary approaches significantly expand research possibilities for ndhE:

Biophysics-biochemistry integration:

  • Nanoscale imaging of electron transport in reconstituted systems

  • Single-molecule studies of conformational dynamics

  • Advanced spectroscopic techniques for tracking electron movement

Synthetic biology-materials science collaborations:

  • Self-assembling bioelectronic materials incorporating ndhE

  • Biomimetic devices inspired by NDH-1 architecture

  • Patterned surfaces for oriented protein complex assembly

Computational-experimental synergies:

  • Molecular dynamics simulations to predict optimal engineering targets

  • Machine learning for protein design optimization

  • Systems modeling of electron transport networks

Cross-disciplinary innovation examples:

Primary FieldComplementary FieldCollaborative OpportunityPotential Outcome
BiochemistryNanotechnologyProtein-based nanostructures Self-assembling bioelectronic systems
Structural BiologyComputational ChemistryQuantum calculations of electron transferPredictive models of efficiency
Synthetic BiologyMaterials ScienceBio-inorganic interfacesLight-harvesting materials
Plant PhysiologyBioengineeringEnhanced photosynthesisImproved carbon fixation systems

The PduA*-based nanofilament approaches demonstrated in cyanobacteria represent an excellent example of such interdisciplinary innovation, combining protein self-assembly principles with synthetic biology to create organized cellular structures .

How might advances in recombinant ndhE research contribute to broader scientific understanding?

Research on recombinant Nostoc sp. ndhE contributes to broader scientific understanding in several ways:

Fundamental biological insights:

  • Evolutionary adaptations in energy transduction systems

  • Structure-function relationships in membrane protein complexes

  • Regulatory networks governing photosynthesis and respiration

Methodological advancements:

  • Improved approaches for membrane protein expression and analysis

  • Novel assay systems for multi-electron transfer processes

  • Advanced imaging techniques for visualizing macromolecular assemblies

Applied science impacts:

  • Biomedical relevance through comparison with human NAD(P)H dehydrogenases

  • Agricultural applications in photosynthesis enhancement

  • Environmental technologies for carbon capture and solar energy conversion

Knowledge transfer metrics:

Research AreaKnowledge ContributionImpact Assessment
Evolutionary biologyAncient origins of electron transportPhylogenetic pattern mapping
BioenergeticsCoupling mechanisms in energy transductionEfficiency measurement advances
Stress physiologyOxidative stress management strategiesCross-system protection principles
BiotechnologyProtein scaffold development Technology transfer to applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.