Recombinant Nostoc sp. Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; all4289; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
ycf4
Target Protein Sequence
MTASTTINKGDSPNGDSSASSVLHQKVLGSRRFSNYWWASIVTLGASGFFLAGISSYLRV NLLIVTDPTQLIFVPQGLVMGLYGTAGLLLASYLWLVILWDLGGGYNDFNRETGNIKIFR WGFPGKNRKIEIGSRIQDIQSVRVDIKEGLNPRRALYLRVKGRRDIPLTRVGQPLSLAEL ETQGAQLARFLGVPLEGL
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Database Links

KEGG: ana:all4289

STRING: 103690.all4289

Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Ycf4 in photosynthetic organisms?

Ycf4 functions as an essential thylakoid membrane protein involved in the assembly of Photosystem I (PSI). In photosynthetic organisms ranging from cyanobacteria to higher plants, Ycf4 acts as a scaffold for PSI assembly, mediating interactions between newly synthesized PSI polypeptides . Studies with Chlamydomonas reinhardtii have demonstrated that Ycf4 is absolutely essential for PSI accumulation, while in cyanobacteria, Ycf4-deficient mutants can still assemble PSI complexes but at significantly reduced levels . The protein forms part of a large macromolecular complex (>1500 kD) that contains PSI subunits and appears to function in the early stages of PSI assembly by facilitating the organization of PSI components .

How conserved is the Ycf4 protein across different photosynthetic organisms?

Ycf4 is highly conserved among photosynthetic organisms from cyanobacteria to higher plants, suggesting its fundamental importance in photosynthetic function . While the core function remains consistent across species, the absolute requirement for Ycf4 varies between organisms. In green algae like Chlamydomonas reinhardtii, Ycf4 is essential for PSI accumulation, whereas cyanobacterial mutants lacking Ycf4 can still assemble PSI, albeit at reduced levels . The conservation of this protein across diverse photosynthetic lineages indicates strong evolutionary pressure to maintain its structure and function in photosynthetic processes.

What structural features characterize the Ycf4-containing complex?

The Ycf4-containing complex is remarkably large, with a molecular mass exceeding 1500 kD. Electron microscopy studies of purified preparations reveal particles measuring approximately 285 × 185 Å, which may represent several large oligomeric states . The complex contains not only Ycf4 but also the opsin-related protein COP2 and several PSI subunits, including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Spectroscopic analysis of the purified complex shows the presence of chlorophylls and carotenoids, with a characteristic red absorption maximum at 680 nm that is typical for PSI . The complex appears to function as a scaffold that facilitates the assembly of PSI components into functional units.

What are the most effective methods for purifying the Ycf4-containing complex?

The most effective purification strategy involves tandem affinity purification (TAP) tagging of the Ycf4 protein. This approach allows for the isolation of the intact Ycf4-containing complex while maintaining its structural integrity. The procedure typically involves:

  • Creating a TAP-tagged Ycf4 construct and transforming it into the organism of interest

  • Confirming proper integration through restriction fragment length polymorphism (RFLP) analysis

  • Solubilizing thylakoid membranes using n-dodecyl-β-D-maltoside (DDM)

  • Performing sucrose gradient ultracentrifugation for initial separation

  • Following with ion exchange column chromatography for further purification

This multistep approach yields a stable Ycf4-containing complex that can be further analyzed by various biochemical and structural techniques. The purified complex appears faintly green due to the presence of chlorophyll-containing polypeptides like PsaA and PsaB, confirming successful isolation of the functional assembly .

How can researchers effectively generate and verify Ycf4 knockout mutants?

Generating reliable Ycf4 knockout mutants requires careful consideration of the complete gene sequence. The methodology typically involves:

  • Designing a transformation vector containing flanking sequences from the regions adjacent to the Ycf4 gene (such as ycf10 as right border and psaI as left border flanking sequences)

  • Inserting a selectable marker cassette (e.g., FLARE-S cassette containing aadA and gfp) between these flanking sequences

  • Transforming the construct into chloroplasts using particle bombardment

  • Selecting transformed lines on media containing appropriate antibiotics (e.g., spectinomycin at 500 mg/L)

  • Performing multiple rounds of selection to achieve homoplasmy

  • Confirming the knockout using PCR and Southern blot analysis

What analytical techniques are most appropriate for studying protein-protein interactions involving Ycf4?

Several complementary techniques can be employed to investigate protein-protein interactions involving Ycf4:

  • Co-immunoprecipitation (Co-IP): Using antibodies against Ycf4 or its potential interacting partners (such as COP2) to pull down protein complexes, followed by immunoblotting to identify associated proteins. This approach has confirmed interactions between Ycf4, COP2, PsaF, and PsaA .

  • Mass Spectrometry: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify proteins in purified Ycf4 complexes with high sensitivity and specificity. This technique has successfully identified PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF as components of the Ycf4 complex .

  • In silico prediction: Computational approaches can predict potential protein-protein interactions. Studies have shown that different regions of Ycf4 interact with different chloroplast proteins, with the C-terminal portion (91 amino acids) making significant contributions to these interactions .

  • Pulse-chase protein labeling: This technique can identify newly synthesized proteins that associate with Ycf4, helping to elucidate the temporal dynamics of complex assembly. Studies using this approach have revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex .

How does the phenotype of Ycf4 knockout mutants differ across photosynthetic species?

The phenotypic consequences of Ycf4 knockout vary significantly between photosynthetic species, reflecting different degrees of dependency on this assembly factor:

SpeciesKnockout PhenotypeGrowth CharacteristicsPhotosynthetic CapacityReference
CyanobacteriaMild impairmentViableReduced PSI levels but still functional
Chlamydomonas reinhardtiiSevere impairmentViable but compromisedEssential for PSI accumulation
Tobacco (partial knockout)Moderate impairmentPhotoautotrophic growth possibleReduced photosynthetic efficiency
Tobacco (complete knockout)Severe impairmentUnable to grow photoautotrophicallyDependent on external carbon source

Complete Ycf4 knockout tobacco plants exhibit extreme light sensitivity, being unable to grow at light intensities higher than 80 μE m⁻² s⁻¹ . Even under low-light conditions (40-50 μE m⁻² s⁻¹), growth is severely retarded, though plants can eventually reach the reproductive stage . These differences highlight the varying evolutionary adaptations and compensatory mechanisms across photosynthetic lineages.

What ultrastructural changes occur in chloroplasts of Ycf4 knockout mutants?

Transmission electron microscopy (TEM) studies reveal significant ultrastructural alterations in chloroplasts lacking Ycf4:

  • Size and shape changes: Chloroplasts in wild-type plants are typically oblong and larger, while those in knockout plants are more rounded and smaller .

  • Thylakoid membrane organization: Wild-type plants have densely packed thylakoid membranes, whereas knockout plants show less discrete grana thylakoids with disrupted orderly structure .

  • Membrane integrity: Knockout plants exhibit the appearance of vesicular structures in chloroplasts as thylakoid membranes become less organized .

  • Pigmentation: Homoplasmic Δycf4 plants display a light green phenotype initially, with leaves becoming pale yellow as the plants age, indicating progressive chlorophyll degradation or impaired synthesis .

These ultrastructural abnormalities directly correlate with the functional impairment of photosynthesis in Ycf4 knockout plants and demonstrate the critical role of Ycf4 in maintaining proper chloroplast architecture.

How does Ycf4 contribute to the assembly process of Photosystem I?

Ycf4 functions as a scaffold protein in the assembly of PSI complexes, facilitating several critical steps in the biogenesis pathway:

  • Initial recruitment: Ycf4 interacts with newly synthesized PSI polypeptides, as demonstrated by pulse-chase protein labeling experiments .

  • Scaffold formation: The large Ycf4-containing complex (>1500 kD) provides a structural framework for the organization of PSI components .

  • Subunit coordination: Ycf4 mediates interactions between PSI proteins, particularly core subunits like PsaA and PsaB, which are detected in association with the Ycf4 complex as a pigment-containing subcomplex .

  • Stabilization: The complex appears to stabilize partially assembled PSI intermediates, allowing for the proper integration of cofactors (chlorophylls, carotenoids) as indicated by the absorption spectrum of purified preparations showing the characteristic red absorption maximum at 680 nm .

  • Assisted assembly: While cyanobacteria can assemble PSI without Ycf4 (albeit at reduced levels), eukaryotic photosynthetic organisms have evolved a stronger dependence on Ycf4 for efficient PSI assembly .

The intimate association between Ycf4 and COP2 (an opsin-related protein) suggests additional regulatory mechanisms may be involved, though COP2 reduction to 10% of wild-type levels does not affect PSI accumulation, indicating it is not essential for assembly .

What are the implications of the differential light sensitivity observed in Ycf4 knockout mutants?

The extreme light sensitivity of Ycf4 knockout mutants (unable to grow at light intensities greater than 80 μE m⁻² s⁻¹) has significant implications for understanding photosynthetic regulation and stress responses . This phenomenon suggests:

The ability of Δycf4 plants to grow under extremely low light conditions, albeit slowly, suggests that minimal PSI function may still occur or that alternative electron transport pathways become more significant under these conditions .

How does the function of Ycf4 in cyanobacteria like Nostoc sp. compare to its role in higher plants?

The functional role of Ycf4 shows intriguing evolutionary differences between cyanobacteria like Nostoc sp. and higher plants:

CharacteristicCyanobacteria (e.g., Nostoc sp.)Higher Plants (e.g., Tobacco)
EssentialityNot strictly essential; mutants can assemble PSI at reduced levelsEssential; complete knockout prevents photoautotrophic growth
Complex associationForms part of a PSI assembly complexForms larger, more stable complexes with additional partners
Evolutionary adaptationMore flexible assembly pathwaysMore rigid dependency on Ycf4-mediated assembly
Assembly efficiencyCan assemble PSI through alternative mechanismsHeavily reliant on Ycf4 for efficient PSI assembly

This evolutionary divergence suggests that as photosynthetic organisms evolved from prokaryotic cyanobacteria to eukaryotic plants, the PSI assembly process became more specialized and dependent on Ycf4 . In cyanobacteria like Nostoc, the simpler cellular organization may allow for more flexibility in assembly pathways, while the compartmentalized nature of chloroplasts in higher plants necessitates a more structured assembly process mediated by dedicated factors like Ycf4.

What is the significance of the association between Ycf4 and the opsin-related protein COP2?

The intimate and exclusive association between Ycf4 and COP2 revealed by copurification experiments suggests a specialized functional relationship that merits further investigation . The significance of this association includes:

  • Structural considerations: COP2 may contribute to the stability of the large Ycf4-containing complex, as indicated by increased salt sensitivity of the Ycf4 complex when COP2 is reduced to 10% of wild-type levels .

  • Regulatory potential: As an opsin-related protein, COP2 may play a role in sensing light conditions or other environmental cues that could modulate PSI assembly in response to changing conditions.

  • Evolutionary implications: The association with COP2 may represent an adaptation that enhances the efficiency or regulation of PSI assembly in specific photosynthetic lineages.

  • Functional redundancy: Despite their tight association, COP2 reduction does not affect PSI accumulation, suggesting that while it may optimize the process, it is not essential for the core assembly function .

This association presents an interesting target for further research into the fine-tuning of photosynthetic apparatus assembly and potentially reveals novel regulatory mechanisms in photosynthetic organisms.

What expression systems are most suitable for producing recombinant Nostoc sp. Ycf4 protein?

When selecting an expression system for recombinant Nostoc sp. Ycf4 production, researchers should consider several factors:

The tandem affinity purification (TAP) tagging approach has proven successful for Ycf4 purification from Chlamydomonas reinhardtii, suggesting that similar strategies could be effective for Nostoc sp. Ycf4 . When designing recombinant constructs, it's important to consider that the TAP tag may affect protein accumulation levels, as observed in C. reinhardtii where TAP-tagged Ycf4 decreased to approximately 25% of wild-type levels .

What purification strategies optimize yield and maintain the functional integrity of recombinant Ycf4?

Optimal purification of functional recombinant Ycf4 requires strategies that preserve its native conformation and associated cofactors:

  • Membrane solubilization: Careful selection of detergents is critical. n-Dodecyl-β-D-maltoside (DDM) has been successfully used to solubilize Ycf4-containing complexes while maintaining their integrity .

  • Affinity chromatography: TAP-tagging allows for efficient purification under mild conditions. The two-step purification process involves:

    • Initial capture on IgG Sepharose

    • TEV protease cleavage to release the complex

    • Secondary capture on calmodulin resin

    • Elution under gentle conditions with EGTA

  • Size-based separation: Sucrose density gradient ultracentrifugation effectively separates the large Ycf4-containing complex (>1500 kD) from other cellular components .

  • Ion exchange chromatography: This provides additional purification and can be used to concentrate the purified complex .

  • Storage considerations: The purified complex should be maintained in buffers containing appropriate detergent concentrations and stored under conditions that prevent protein aggregation or denaturation.

When assessing purity and integrity, researchers should employ multiple analytical techniques, including SDS-PAGE, immunoblotting, absorption spectroscopy, and electron microscopy to confirm the presence of the characteristic 285 × 185 Å particles .

How can researchers effectively characterize the molecular interactions of recombinant Ycf4 with PSI components?

To characterize the molecular interactions between recombinant Ycf4 and PSI components, researchers can employ several complementary approaches:

  • In vitro reconstitution assays: Combining purified recombinant Ycf4 with isolated PSI subunits under controlled conditions to assess binding affinities and complex formation.

  • Surface plasmon resonance (SPR): This technique can provide quantitative measurements of binding kinetics between Ycf4 and individual PSI subunits or subcomplexes.

  • Crosslinking coupled with mass spectrometry: Chemical crosslinking followed by proteomic analysis can identify specific contact points between Ycf4 and its interaction partners.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can reveal regions of Ycf4 that undergo conformational changes upon interaction with PSI components.

  • Structural studies: Cryo-electron microscopy has proven valuable for characterizing the Ycf4-containing complex, revealing particles measuring 285 × 185 Å . X-ray crystallography or cryo-EM of the reconstituted complexes could provide atomic-level details of these interactions.

  • Mutational analysis: Systematic mutation of conserved residues in Ycf4 can identify regions critical for interaction with specific PSI subunits. The finding that the C-terminal portion (91 amino acids) of Ycf4 interacts with chloroplast proteins suggests this region is particularly important for functional interactions .

By combining these approaches, researchers can develop a comprehensive understanding of how Ycf4 facilitates PSI assembly at the molecular level, potentially informing strategies to engineer more efficient photosynthetic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.