Recombinant Nostoc sp. Photosystem I reaction center subunit III (psaF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaF; all0109; Photosystem I reaction center subunit III; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-164
Protein Length
Full Length of Mature Protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
psaF
Target Protein Sequence
LGADLTPCAENPAFQALAKNARNTTADPQSGQKRFERYSQALCGPEGYPHLIVDGRLDRA GDFLIPSILFLYIAGWIGWVGRAYLQAIKKDSDTEQKEIQLDLGIALPIIATGFAWPAAA VKELLSGELTAKDSEITVSPR
Uniprot No.

Target Background

Function
This protein likely participates in efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). It functions as a plastocyanin-docking protein, facilitating the specific interaction of plastocyanin with Photosystem I.
Database Links

KEGG: ana:all0109

STRING: 103690.all0109

Protein Families
PsaF family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of psaF in the Photosystem I complex of Nostoc sp.?

Photosystem I reaction center subunit III (psaF) is a transmembrane protein that plays a crucial role in the electron transfer processes of photosynthesis. Based on structural and functional studies, psaF primarily facilitates the docking of electron donors, particularly plastocyanin (Pc) and cytochrome c6 (Cyt c6), to the Photosystem I (PSI) complex. The N-terminal domain of psaF extends into the lumenal space, providing a specific binding site for these mobile electron carriers . In cyanobacteria like Nostoc sp., psaF is essential for maintaining efficient electron transfer from these soluble donors to the P700+ reaction center, which is the primary electron donor in PSI. Research has shown that in the absence of psaF or when its orientation is disrupted, the kinetics of electron transfer from Pc and Cyt c6 to P700+ are significantly slowed, demonstrating its importance in maintaining photosynthetic efficiency .

How does psaF interact with other subunits in the Photosystem I complex?

PsaF operates within a complex network of protein-protein interactions in the PSI complex. Of particular importance is its interaction with PsaJ, a small hydrophobic subunit. Experimental evidence from mutant studies has revealed that PsaJ helps maintain psaF in its proper orientation within the membrane. When PsaJ is absent, approximately 70% of psaF molecules become functionally compromised despite being physically present in the complex .

The interaction between psaF and other core subunits (particularly PsaA and PsaB) also influences the positioning of chlorophyll molecules and other cofactors involved in the electron transfer chain. In the PSI complex, psaF is positioned near the periphery where it can interact with the lumenal electron donors while maintaining appropriate connections to the core structure. The proper alignment of psaF is critical for ensuring efficient electron transfer from soluble donors to the reaction center .

What expression systems are most effective for producing recombinant Nostoc sp. psaF protein?

Recombinant Nostoc sp. psaF can be produced using several expression systems, each with specific advantages depending on research objectives. Based on current methodologies, the following systems have proven effective:

  • E. coli expression system: Most commonly used due to its simplicity, rapid growth, and high yield. Typically employs pET vector systems with T7 promoters for controlled expression .

  • Yeast expression systems: Useful when post-translational modifications are necessary. Both Saccharomyces cerevisiae and Pichia pastoris have been used successfully.

  • Baculovirus expression system: Appropriate for studies requiring more complex folding environments.

  • Mammalian cell expression: Used when specific mammalian post-translational modifications are needed for interaction studies.

  • Cell-free expression systems: Allow for rapid production and avoid potential toxicity issues that might occur in cellular systems .

For purification, researchers typically employ a combination of affinity chromatography (using His-tags), ion exchange chromatography, and size exclusion chromatography to achieve ≥85% purity as determined by SDS-PAGE . Expression should be optimized based on specific experimental requirements, particularly if the recombinant protein will be used for functional reconstitution or structural studies.

How can researchers accurately assess the functional integrity of recombinant psaF protein?

Assessing the functional integrity of recombinant psaF requires multiple complementary approaches:

  • Flash-absorption spectroscopy: This technique directly measures electron transfer kinetics between purified psaF-containing PSI complexes and electron donors (plastocyanin or cytochrome c6). Functional psaF exhibits rapid electron transfer kinetics, while compromised psaF shows slower kinetics similar to psaF-deficient PSI complexes .

  • Cross-linking studies: Chemical cross-linking between the N-terminal domain of psaF and its electron donor proteins (Pc or Cyt c6) confirms proper folding and exposure of the binding domain. This can be analyzed using SDS-PAGE and western blotting .

  • Reconstitution assays: Incorporating recombinant psaF into psaF-deficient PSI complexes to restore electron transfer function provides direct evidence of proper folding and functionality.

  • Circular dichroism spectroscopy: Useful for assessing secondary structure integrity and proper folding of the isolated subunit.

  • Thermal stability assays: Techniques such as differential scanning fluorimetry can evaluate the stability of the recombinant protein, which correlates with its native-like structure.

To ensure comprehensive assessment, researchers should combine multiple methods and compare results with wild-type psaF as a positive control and psaF-deficient samples as a negative control .

What structural features of psaF are critical for its interaction with electron donors?

The structural features of psaF critical for electron donor interactions include:

  • N-terminal domain: The extended N-terminal region of psaF contains positively charged lysine residues that form an essential recognition patch for the negatively charged surfaces of plastocyanin and cytochrome c6 . This electrostatically-driven interaction facilitates the initial docking of these electron donors.

  • Alpha-helical structures: The N-terminal domain contains alpha-helical regions that provide the correct spatial orientation of binding residues. These structural elements create a recognition surface compatible with the electron donors' topology.

  • Transmembrane anchoring: The hydrophobic transmembrane region anchors psaF in the thylakoid membrane, positioning the N-terminal domain in the lumenal space where it can interact with soluble electron carriers.

  • PsaJ-interacting interface: The portion of psaF that interacts with PsaJ is critical for maintaining proper orientation. Research with PsaJ-deficient mutants shows that when this interaction is lost, the N-terminal domain of psaF may still be exposed to the lumen but is displaced from its optimal position, resulting in dramatically reduced electron transfer efficiency despite the presence of the protein .

Mutagenesis studies targeting these regions have demonstrated their importance for both the binding affinity and electron transfer kinetics between PSI and its electron donors.

How does the absence of PsaJ affect the functionality of psaF in Nostoc sp.?

The absence of PsaJ has profound effects on psaF functionality despite not affecting psaF protein levels. Key impacts include:

These findings demonstrate that PsaJ serves as a structural support that maintains psaF in an orientation conducive to optimal electron transfer, highlighting the importance of protein-protein interactions in modulating the functionality of individual subunits within the PSI complex.

How can site-directed mutagenesis of psaF advance our understanding of PSI electron transfer dynamics?

Site-directed mutagenesis of psaF offers a powerful approach for dissecting the molecular mechanisms of PSI electron transfer:

  • Charge reversal mutations: Introducing mutations that alter the charged residues in the N-terminal domain can probe the electrostatic interactions with electron donors. For example, converting positively charged lysine residues to negatively charged glutamate residues would be expected to disrupt the interaction with the negatively charged surfaces of plastocyanin and cytochrome c6 .

  • Domain-swapping experiments: Replacing portions of Nostoc sp. psaF with corresponding regions from other species can identify species-specific differences in electron transfer efficiency and binding preferences for different donors.

  • Cysteine-scanning mutagenesis: Introducing cysteine residues at different positions allows for site-specific labeling with spectroscopic probes or cross-linking agents, providing detailed insights into the dynamic interactions during electron transfer.

  • Probing PsaJ interaction interface: Mutations at the interface between psaF and PsaJ can help define the molecular details of this interaction and its role in maintaining proper psaF orientation .

  • Structure-guided mutations: Based on structural data, mutations can be designed to alter specific hydrogen bonds or van der Waals interactions with neighboring subunits or cofactors to assess their contribution to electron transfer efficiency.

These approaches, combined with techniques such as time-resolved spectroscopy, can provide mechanistic insights into the factors controlling electron transfer rates and efficiencies in PSI, potentially informing the design of artificial photosynthetic systems.

What role might psaF play in the adaptation of cyanobacteria to different light environments?

The adaptation of psaF to different light environments represents an intriguing area of research with several key considerations:

Comparative studies of psaF function in cyanobacteria from different light environments, combined with experimental manipulation of light conditions, could provide insights into its role in photosynthetic adaptation.

What are the common challenges in isolating functional PSI complexes containing recombinant psaF?

Isolating functional PSI complexes with recombinant psaF presents several challenges that researchers should anticipate:

  • Membrane protein solubilization: PSI is a large membrane protein complex, and effective solubilization requires careful optimization of detergent type, concentration, and solubilization conditions to maintain structural integrity. Commonly used detergents include n-dodecyl-β-D-maltoside (DDM), digitonin, and lauryldimethylamine oxide (LDAO) .

  • Complex stability during purification: PSI complexes may dissociate or lose cofactors during purification. Including stabilizing agents such as glycerol and appropriate salt concentrations in all buffers is essential.

  • Maintaining pigment-protein interactions: The numerous chlorophyll molecules in PSI are crucial for function but can be lost during harsh purification procedures, resulting in non-functional complexes .

  • Recombinant subunit incorporation: Ensuring that recombinant psaF properly incorporates into the PSI complex requires careful reconstitution procedures or in vivo expression systems that allow assembly of the complex with the modified subunit.

  • Assessing complex integrity: Comprehensive characterization using a combination of absorption spectroscopy, SDS-PAGE, BN-PAGE, and electron microscopy is necessary to confirm that the isolated complexes maintain their native structure and composition .

  • Functional validation: Flash-absorption spectroscopy to measure electron transfer kinetics is essential to confirm that the isolated complexes with recombinant psaF are functionally active .

Researchers should establish rigorous quality control procedures and validate their preparations using wild-type PSI as a reference standard before conducting experiments with recombinant variants.

How can researchers distinguish between protein expression issues and functional defects when studying recombinant psaF mutants?

Distinguishing between expression issues and true functional defects is critical for accurate interpretation of mutant studies:

  • Quantitative protein analysis: Western blotting with antibodies specific to psaF can quantify protein levels. Additionally, mass spectrometry-based proteomics can provide absolute quantification of psaF and other PSI subunits .

  • Subcellular localization: Immunogold electron microscopy or fluorescence microscopy with tagged proteins can confirm proper localization of psaF to thylakoid membranes.

  • Complex assembly assessment: Blue-native PAGE followed by western blotting can determine whether psaF is incorporated into PSI complexes at levels comparable to wild type .

  • Isolation of pure complex populations: Size-exclusion chromatography or sucrose gradient centrifugation can separate fully assembled PSI complexes from partially assembled intermediates for further analysis .

  • Functional assays with isolated complexes: Studies with PsaJ-deficient mutants have shown that PSI can contain normal levels of psaF but with compromised function . Therefore, isolated complex function should be assessed using:

    • Flash absorption spectroscopy to measure electron transfer kinetics

    • Cross-linking studies to assess interaction with electron donors

    • Spectroscopic measurements to evaluate pigment organization and energy transfer

  • Complementation tests: Reintroducing wild-type psaF into mutant strains should restore function if the defect is specifically due to the mutation rather than secondary effects on expression or assembly.

By systematically applying these approaches, researchers can differentiate between mutations that affect psaF expression, PSI assembly, or the specific function of properly assembled complexes.

What are the typical yield and purity specifications for recombinant Nostoc sp. psaF production?

Based on current methodologies, the following specifications are typical for recombinant Nostoc sp. psaF production:

Expression SystemTypical YieldAchievable PurityValidation Method
E. coli10-15 mg/L culture≥85%SDS-PAGE
Yeast5-10 mg/L culture≥85%SDS-PAGE
Baculovirus2-5 mg/L culture≥85%SDS-PAGE
Cell-free expression0.5-2 mg/mL reaction≥85%SDS-PAGE

Purification protocols typically employ a multi-step approach:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Ion exchange chromatography

  • Size exclusion chromatography

For functional studies, additional criteria beyond simple purity include:

  • Secondary structure confirmation by circular dichroism

  • Thermal stability assessment

  • Proper folding verification through binding assays with electron donor proteins

The recombinant protein should be tested for functionality by reconstitution into PSI complexes and assessment of electron transfer rates to ensure that the purified protein maintains its native-like properties .

What spectroscopic signatures characterize correctly folded and functional psaF within PSI complexes?

Correctly folded and functional psaF within PSI complexes exhibits several characteristic spectroscopic signatures:

  • Absorption spectroscopy:

    • Intact PSI complexes with functional psaF show characteristic absorption peaks at approximately 440 nm and 680 nm, with additional far-red absorption extending beyond 700 nm

    • The ratio of chlorophyll absorption (680 nm) to protein absorption (280 nm) provides an indication of complex integrity

  • Fluorescence spectroscopy:

    • Low fluorescence yield at room temperature, indicating efficient energy transfer to the reaction center

    • Characteristic fluorescence emission maximum at ~720 nm when excited at 440 nm

  • Flash-induced absorbance changes:

    • P700 oxidation can be monitored as an absorbance decrease at 700 nm and increase at 830 nm

    • With functional psaF, re-reduction of P700+ by plastocyanin or cytochrome c6 shows biphasic kinetics with a fast phase (t1/2 of 3-10 μs) dominating

    • In PSI with non-functional psaF (or PSI from psaF-deficient mutants), this fast phase is largely absent, and electron donation occurs primarily through the slow phase (t1/2 of 200-300 μs)

  • Circular dichroism:

    • Characteristic CD spectrum in the visible region reflecting proper organization of chlorophylls

    • The protein region of the CD spectrum (190-260 nm) provides information about secondary structure integrity

  • Electron paramagnetic resonance (EPR):

    • Signals from iron-sulfur clusters (FA, FB, FX) and P700+ can be used to assess electron transfer functionality

These spectroscopic properties, particularly the kinetics of P700+ reduction, provide sensitive probes for the functional state of psaF within the PSI complex and its ability to facilitate efficient electron donation from soluble carriers .

How might structural variations in psaF contribute to different oligomeric states of PSI in various cyanobacterial species?

Current research suggests complex relationships between PSI subunit structure and oligomerization states:

  • Diverse oligomeric states: While PSI predominantly forms trimers in most cyanobacteria, monomers, dimers, tetramers, and higher-order oligomers have been observed in different species and under different conditions . The relationship between psaF variations and these different states remains an active area of investigation.

  • Indirect effects through neighboring subunits: Although psaF is not directly involved in the interface between PSI monomers in trimeric complexes (which primarily involves PsaL), structural variations in psaF could influence the conformation of neighboring subunits that do participate in oligomerization .

  • Species-specific interfaces: The recent discovery of a dimeric PSI in the green alga Chlamydomonas reinhardtii with a completely different orientation compared to cyanobacterial oligomers suggests that novel interfaces can evolve . While this specific case involves the absence of PsaH (not present in cyanobacteria) and roles for Lhca proteins, it highlights the potential for alternative oligomerization mechanisms.

  • PsaL C-terminus variations: The C-terminus of PsaL coordinates a calcium ion between adjacent monomers in cyanobacterial trimers, and variations in this region have been implicated in different oligomerization properties . Interactions between psaF and PsaL could potentially influence this critical region.

  • Environmental regulation: The formation of different oligomeric states may be regulated by environmental factors such as light intensity, temperature, or nutrient availability . Variations in psaF might affect how these environmental signals are transduced into structural changes.

This remains a frontier area where additional structural studies of PSI from diverse cyanobacterial species, combined with targeted mutagenesis of psaF and other subunits, could provide valuable insights into the evolution and regulation of PSI oligomerization.

What approaches are being developed to study the dynamics of psaF interactions with electron donors in real-time?

Cutting-edge approaches for studying the real-time dynamics of psaF-electron donor interactions include:

  • Time-resolved X-ray crystallography and cryo-EM: These techniques can potentially capture different conformational states during the electron transfer process, providing structural snapshots of the interaction between psaF and its electron donors .

  • Single-molecule FRET: By labeling psaF and electron donor proteins with appropriate fluorophore pairs, researchers can monitor binding events and conformational changes in real-time at the single-molecule level, revealing the heterogeneity and dynamics of these interactions.

  • Surface plasmon resonance (SPR) and biolayer interferometry: These label-free techniques allow real-time monitoring of association and dissociation kinetics between immobilized PSI complexes and soluble electron donors under various conditions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can identify regions of psaF that change in solvent accessibility upon interaction with electron donors, providing insights into binding interfaces and conformational changes.

  • Ultrafast spectroscopy: Techniques such as femtosecond transient absorption spectroscopy can track the movement of electrons through the complex in real-time, correlating structural features of psaF with electron transfer rates.

  • Computational approaches: Molecular dynamics simulations can model the dynamic interaction between psaF and electron donors, generating testable hypotheses about key residues and conformational changes that regulate binding and electron transfer.

  • Genetically encoded crosslinkers: Incorporating unnatural amino acids with photo-activatable crosslinking groups at specific positions in psaF could allow capturing transient interactions with electron donors upon light activation.

These advanced methodologies promise to transform our understanding of the dynamic nature of psaF-mediated electron transfer from a static structural view to a dynamic process, potentially revealing new regulatory mechanisms and design principles for artificial photosynthetic systems.

How can studies of Nostoc sp. psaF inform the design of artificial photosynthetic systems?

Research on Nostoc sp. psaF provides valuable insights for artificial photosynthetic systems:

  • Optimizing electron transfer interfaces: Understanding the specific structural features of psaF that facilitate efficient electron transfer from donor proteins can inform the design of interfaces between synthetic light-harvesting complexes and catalytic components .

  • Lessons from evolutionary optimization: The fact that psaF is highly conserved across photosynthetic organisms suggests it represents an evolutionarily optimized solution for electron transfer. Determining the precise factors that have been optimized (e.g., binding affinity, orientation, electrostatic complementarity) can provide design principles for artificial systems .

  • Environmental adaptation mechanisms: Studies of how psaF function varies across cyanobacteria adapted to different environments could reveal strategies for making artificial systems robust under varying conditions .

  • Modular design principles: The relationship between psaF and PsaJ, where PsaJ appears to fine-tune psaF orientation for optimal function, illustrates how modular design with supporting components can enhance primary functional elements .

  • Biomimetic materials: The specific peptide sequences and structural motifs of psaF that interact with electron donors could be incorporated into synthetic peptides or proteins that interface with both biological and artificial components in hybrid systems.

  • System stability considerations: Understanding how psaF maintains stable yet dynamic interactions with electron donors under fluctuating conditions can inform strategies for building artificial systems that balance stability with the flexibility needed for function.

By translating these molecular insights into design principles, researchers can potentially develop more efficient artificial photosynthetic systems for sustainable energy production and carbon fixation.

What potential biotechnology applications might emerge from a deeper understanding of psaF structure and function?

A deeper understanding of psaF structure and function could enable several biotechnology applications:

  • Engineered photosynthetic microorganisms: Modifying psaF to enhance electron transfer efficiency could potentially increase photosynthetic productivity in cyanobacteria engineered for biofuel or high-value compound production . Since the total carbon flux appears to be a key driver for products like polyhydroxyalkanoates (PHAs), enhancements to the photosynthetic electron transport chain could improve yields.

  • Designer electron transfer modules: Engineered psaF variants could be developed as modular components for synthetic electron transport chains in both biological and artificial systems, allowing precise control over electron flow in biotechnological applications.

  • Biosensors: The specific interaction between psaF and electron donors could be exploited to develop biosensors for detecting various analytes by coupling recognition elements to psaF-based electron transfer systems.

  • Bioelectronic interfaces: Understanding how psaF mediates electron transfer between biological molecules could inform the design of interfaces between biological components and electronic devices, advancing bioelectronic applications.

  • Stress-tolerant photosynthetic systems: Insights from studies of psaF in cyanobacteria adapted to extreme environments, such as high light conditions , could guide the development of stress-tolerant photosynthetic systems for biotechnological applications in challenging environments.

  • Natural product discovery platforms: Studies integrating psaF function with broader metabolic networks in cyanobacteria could enhance platforms for discovering bioactive natural products from Nostoc and related cyanobacteria , potentially leading to new drug candidates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.