Recombinant Nostoc sp. Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
psaL; all0107; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
psaL
Target Protein Sequence
MAQAVDASKNLPSDPRNREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPF RRGLEVGMAHGYFLFGPFAKLGPLRDAANANLAGLLGAIGLVVLFTLALSLYANSNPPTA LASVTVPNPPDAFQSKEGWNNFASAFLIGGIGGAVVAYFLTSNLALIQGLVG
Uniprot No.

Target Background

Database Links

KEGG: ana:all0107

STRING: 103690.all0107

Protein Families
PsaL family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem I reaction center subunit XI (psaL) and what is its primary function?

The PsaL protein serves as a critical structural component of Photosystem I (PSI), functioning primarily in the organization of PSI complexes into different oligomeric states. In cyanobacteria, PsaL is essential for the formation of PSI trimers and tetramers through specific PsaL-PsaL interactions at the interfaces between PSI monomers . The protein contains multiple transmembrane helices and plays a crucial role in both the structural stability and functional efficiency of PSI complexes. In Nostoc sp. (strain PCC 7120 / UTEX 2576), the PsaL protein is encoded by the psaL gene (locus name: all0107) and is alternatively known as PSI subunit V or PSI-L .

What are the optimal storage and handling conditions for recombinant Nostoc sp. PsaL protein?

For optimal stability and activity preservation, the recombinant PsaL protein should be stored according to the following protocol:

ParameterRecommended ConditionNotes
Short-term storage4°CUp to one week
Long-term storage-20°C or -80°CPreferred for extended storage
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Freeze-thaw cyclesMinimizeRepeated freezing and thawing is not recommended

Working aliquots should be maintained at 4°C for up to one week to minimize degradation from repeated freeze-thaw cycles .

How can researchers effectively isolate and purify recombinant Nostoc sp. PsaL for structural studies?

Isolation and purification of recombinant PsaL requires careful consideration of the protein's hydrophobic nature and its natural environment within the thylakoid membrane. A systematic approach includes:

  • Expression system selection: Escherichia coli systems with specialized tags for membrane proteins often yield better results than standard expression systems.

  • Solubilization protocol:

    • Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Maintain buffer pH between 7.0-8.0

    • Include glycerol (10-20%) to stabilize the protein

  • Purification strategy:

    • Initial purification via immobilized metal affinity chromatography (IMAC)

    • Secondary purification using size exclusion chromatography

    • Optional ion exchange chromatography for higher purity

  • Quality assessment:

    • SDS-PAGE to confirm protein size (approximately 18-20 kDa)

    • Western blotting with anti-PsaL antibodies

    • Circular dichroism to verify secondary structure integrity

This approach preserves the native structure while providing sufficient yield for subsequent structural and functional analyses .

What genomic organization patterns of the psaL gene correlate with PSI oligomeric states in cyanobacteria?

Research has revealed distinct patterns between psaL genomic organization and PSI oligomeric states:

Genomic ArrangementTypical PSI Oligomeric StateRepresentative Organisms
psaF/J/LTetrameric/Dimeric PSIHeterocyst-forming cyanobacteria (HCR)
psaL/ITrimeric PSIMost non-HCR cyanobacteria
dual copies (psaF/J/L and psaL/I)Mixed (predominantly tetrameric)Fischerella muscicola PCC 7414

In heterocyst-forming cyanobacteria, the psaL gene is consistently found downstream of psaF and psaJ genes (psaF/J/L arrangement), and these species predominantly form tetrameric or dimeric PSI. Some species possess two copies of the psaL gene, with one copy in the psaF/J/L locus and another in the psaL/I locus. Interestingly, proteomic analyses of PSI from species with dual copies show that the PsaL protein encoded by the psaF/J/L locus is primarily incorporated into both tetrameric and trimeric PSI complexes under standard growth conditions .

How do gene replacement experiments demonstrate the role of PsaL in determining PSI oligomeric states?

Gene replacement experiments have been instrumental in understanding PsaL's role in PSI oligomerization. When the wild-type PsaL in Synechocystis sp. PCC 6803 (which naturally forms trimeric PSI) was replaced with PsaL from:

  • TS-821 (tetrameric PSI-forming species): Resulted in monomeric PSI

  • Arabidopsis (plant, monomeric PSI): Also resulted in monomeric PSI

Importantly, Western blot analysis confirmed that these PSI complexes still contained the heterologous PsaL protein, indicating that the monomerization was not due to failed assembly of PsaL into PSI. These findings demonstrate that specific structural features of PsaL, rather than merely its presence, determine PSI oligomerization capacity .

The most significant structural feature appears to be the proline-rich motif in the loop between the second and third transmembrane helices. This region is highly conserved among heterocyst-forming cyanobacteria with tetrameric PSI but differs in species with trimeric PSI. The conservation pattern suggests evolutionary adaptation of PsaL structure for different ecological niches .

What is the significance of the proline-rich motif in PsaL and how can it be experimentally analyzed?

The proline-rich motif (often NPPxP followed by PNPP) found in the loop between the second and third transmembrane helices of PsaL appears to be a key determinant in PSI oligomerization:

  • Structural impact: The proline residues likely create rigid bends in the protein backbone, affecting the three-dimensional conformation of PsaL and its interaction interfaces with adjacent monomers.

  • Experimental approaches to analyze this motif:

    • Site-directed mutagenesis to modify specific proline residues

    • Circular dichroism spectroscopy to assess changes in secondary structure

    • Blue-native PAGE to evaluate oligomeric state changes

    • X-ray crystallography or cryo-EM to determine atomic-level structural alterations

  • Expected results pattern:

    Proline ModificationExpected Effect on PSI Oligomerization
    Conservative substitutionsMinimal impact
    Removal of key prolinesDisruption of higher-order oligomers
    Introduction of additional prolinesPotentially enhanced oligomerization

Research indicates that even cyanobacteria with predominantly monomeric PSI, such as PCC 6605, may share this motif, suggesting a complex role beyond simple oligomer determination .

What are the optimal conditions for cultivating Nostoc sp. to maximize recombinant PsaL production?

Optimizing Nostoc sp. cultivation requires careful control of growth parameters:

ParameterOptimal ConditionEffect on Growth
Initial biomass concentration1.0 g·L⁻¹Highest specific growth rate (0.222 ± 0.018 μ·day⁻¹)
Culture mediummBG11Highest growth rate (0.149 ± 0.0237 μ·day⁻¹) and productivity (2.195 ± 0.847 g·L⁻¹·day⁻¹)
Alternative mediumNutribloomModerate growth (0.1010 ± 0.009 μ·day⁻¹)
Suboptimal mediumFloraNovaPoor growth (0.010 ± 0.0229 μ·day⁻¹)

These cultivation parameters significantly impact biomass yield, which directly affects the quantity of PSI complexes and PsaL that can be isolated. While mBG11 medium consistently provides the best growth results, commercial alternatives like Nutribloom may be suitable for less demanding applications or preliminary studies .

How can heterologous expression systems be optimized for recombinant Nostoc sp. PsaL production?

Heterologous expression of membrane proteins like PsaL presents significant challenges. Optimization strategies include:

  • Expression host selection:

    • E. coli strains C41(DE3) or C43(DE3): Engineered for membrane protein expression

    • Synechocystis sp. PCC 6803: Homologous environment for proper folding

    • Insect cell lines: For more complex folding requirements

  • Vector design considerations:

    • Codon optimization for the host organism

    • Inclusion of solubility-enhancing fusion partners (SUMO, MBP)

    • Inducible promoters with titratable expression levels

    • Signal sequences for membrane targeting

  • Expression conditions optimization matrix:

    ParameterRange to TestMonitoring Method
    Temperature16-30°CSDS-PAGE, Western blot
    Inducer concentration0.1-1.0 mM IPTGSDS-PAGE, Western blot
    Expression duration4-48 hoursTime-course sampling
    Media compositionVarious carbon sourcesOptical density tracking
  • Extraction efficiency assessment:

    • Compare detergent types (DDM, LDAO, OG)

    • Test various detergent concentrations

    • Evaluate mechanical disruption methods

The choice between native purification from Nostoc sp. versus heterologous expression depends on research requirements for protein quantity, post-translational modifications, and structural authenticity .

What spectroscopic methods are most effective for characterizing PsaL's role in PSI complexes?

Multiple spectroscopic approaches provide complementary insights into PsaL's role:

Each method offers distinct advantages for assessing how PsaL modifications impact the structural and functional properties of PSI complexes .

How can researchers experimentally determine the impact of PsaL modifications on PSI electron transfer efficiency?

The impact of PsaL modifications on electron transfer can be systematically evaluated through:

Though PsaL is not directly involved in the electron transfer chain, its structural role can indirectly affect electron transfer by altering the organization of other subunits and their associated cofactors. These measurements provide insights into how different oligomeric states impact the efficiency of light energy conversion .

How does PsaL from Nostoc sp. compare structurally and functionally with PsaL from other photosynthetic organisms?

Comparative analysis reveals significant evolutionary adaptations in PsaL across different photosynthetic lineages:

Organism TypePSI Oligomeric StateKey PsaL FeaturesGenomic Organization
Heterocyst-forming cyanobacteria (Nostoc)Tetrameric/DimericProline-rich loop motifpsaF/J/L
Non-heterocystous cyanobacteriaTrimericDifferent loop structurepsaL/I
Plants (e.g., Spinacia, Arabidopsis)MonomericInteraction with PsaHDifferent genetic context
Red algaeTrimericCyanobacteria-likeSimilar to cyanobacteria
Green algaeMixed (species-dependent)Intermediate featuresVariable arrangements

The key structural differences include:

  • The loop region between the second and third transmembrane helices, which contains species-specific motifs

  • Surface residues involved in oligomer formation

  • The presence or absence of specific interaction domains for other PSI subunits

These differences reflect evolutionary adaptation to different ecological niches and photosynthetic strategies. The monomeric PSI in plants, facilitated by the interaction between PsaL and plant-specific PsaH, represents a significant evolutionary divergence from the cyanobacterial ancestral form .

What is the evolutionary significance of different psaL gene arrangements and their correlation with PSI oligomerization?

The evolutionary relationship between psaL genomic organization and PSI oligomerization reveals important insights into photosynthetic adaptation:

  • Phylogenetic distribution:

    • The psaF/J/L arrangement (associated with tetrameric PSI) is found exclusively in heterocyst-forming cyanobacteria

    • The psaL/I arrangement (associated with trimeric PSI) is more widespread among cyanobacteria

  • Evolutionary implications:

    • The distinct psaL arrangements likely arose through gene duplication and rearrangement events

    • The correlation with nitrogen fixation capability (heterocysts) suggests functional adaptation

    • Some species maintain dual copies of psaL genes, potentially for environmental adaptability

  • Functional adaptation hypothesis:

    • Tetrameric PSI may provide advantages in low-light environments typical of heterocyst-forming species

    • Different oligomeric states may optimize light-harvesting under varying ecological conditions

    • Far-red light acclimation appears to correlate with specific PsaL variants (encoded in psaL/I arrangement)

This evolutionary diversification of PsaL and PSI oligomeric states represents a fundamental adaptation mechanism in photosynthetic organisms, potentially enabling exploitation of different ecological niches through optimized light-harvesting strategies .

How can engineered variations of Nostoc sp. PsaL be utilized to develop enhanced photosynthetic systems?

Engineering PsaL variants offers several promising research applications:

  • Photosynthetic efficiency enhancement:

    • Targeted modifications of PsaL to favor specific oligomeric states optimized for different light conditions

    • Engineering of the proline-rich loop region to fine-tune PSI assembly and stability

    • Creation of hybrid PsaL proteins combining features from different species

  • Bioelectronic applications:

    • Design of PSI complexes with controlled orientation for biophotoelectrode development

    • Engineering attachment sites for conductive surfaces while maintaining function

    • Optimization of electron transfer efficiency for biophotovoltaic devices

  • Synthetic biology platforms:

    • Integration of modified PSI complexes into artificial photosynthetic systems

    • Development of modular photosynthetic components for custom assembly

    • Creation of minimal PSI units with enhanced stability for biotechnological applications

  • Research milestones framework:

    Research PhaseTimelineKey Deliverables
    Structure-function analysis1-2 yearsIdentification of critical PsaL residues for oligomerization
    Directed evolution2-3 yearsPsaL variants with enhanced stability/function
    Prototype applications3-5 yearsProof-of-concept devices utilizing engineered PSI

These applications could lead to significant advances in artificial photosynthesis, bioenergy production, and environmental biotechnology .

What emerging techniques will advance understanding of PsaL's role in photosynthetic efficiency and adaptation?

Several cutting-edge methodologies are poised to transform our understanding of PsaL:

  • Cryo-electron microscopy advancements:

    • Time-resolved cryo-EM to capture dynamic states of PSI assembly

    • High-resolution structures of different oligomeric states to resolve atomic details

    • In situ structural determination within native membrane environments

  • Advanced spectroscopic approaches:

    • Ultra-fast transient absorption spectroscopy to resolve energy transfer events

    • Single-molecule spectroscopy to detect conformational heterogeneity

    • 2D electronic spectroscopy to map energy coupling between chromophores

  • Genetic and synthetic biology tools:

    • CRISPR-Cas9 engineering of cyanobacterial strains with modified PsaL

    • High-throughput mutagenesis coupled with phenotypic screening

    • Synthetic minimal PSI systems with defined components

  • Computational approaches:

    • Molecular dynamics simulations of PsaL-mediated oligomerization

    • Quantum mechanics/molecular mechanics modeling of electron transfer

    • Machine learning prediction of structure-function relationships

These emerging techniques, especially when used in complementary combinations, will provide unprecedented insights into the structural dynamics, evolutionary significance, and functional role of PsaL in photosynthetic efficiency and environmental adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.