Recombinant Nostoc sp. Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Table 2: Recombinant CP47 Production Parameters

ParameterDetailsSource
Host OrganismE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
StabilityLyophilized in Tris/PBS buffer + 6% trehalose

Role in PSII Assembly

  • Mutant Analysis: CP47 knockout strains fail to assemble functional PSII, underscoring its scaffolding role .

  • Chlorophyll Availability: Increased chlorophyll precursors (e.g., Mg-protoporphyrin IX) enhance CP47 stability and PSII assembly efficiency .

Stability and Turnover

  • Half-Life: ~15 hours in Synechocystis sp., independent of small CAB-like proteins (SCPs) .

  • Degradation: Degrades independently of D1/D2, suggesting distinct repair pathways for antenna versus reaction center components .

Regulatory Interactions

  • PII Protein Modulation: Under nitrogen-replete conditions, CP47 expression is influenced by the PII signaling protein, which integrates metabolic signals .

  • BMAA Toxin Effects: The neurotoxin β-N-methylamino-L-alanine (BMAA) alters CP47 levels by disrupting nitrogen regulatory networks .

Biotechnological Applications

  • Photosynthesis Research: Recombinant CP47 enables structural studies (e.g., cryo-EM) to resolve energy transfer mechanisms .

  • Stress Tolerance Engineering: Overexpression of psbB in cyanobacteria may enhance PSII resilience under high-light or oxidative stress .

  • Biohybrid Systems: Integration into artificial photosynthetic systems for solar energy conversion .

Challenges and Future Directions

  • Expression Optimization: Improving yields in heterologous hosts remains a hurdle due to CP47’s hydrophobicity and chlorophyll dependency .

  • Functional Reconstitution: Incorporating recombinant CP47 into intact PSII complexes in vitro requires precise lipid and cofactor conditions .

  • Evolutionary Studies: Comparative analyses of CP47 variants across cyanobacteria could elucidate adaptation mechanisms to diverse light environments .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your requirement when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributor.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of that specific tag.
Synonyms
psbB; all0138; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-509
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGSMALYELAIYDPSDPVLNPMWRQGM FVLPFMARLGVTQSWGGWSVTGGTATDPGFWSFEGVAAAHIVLSGLLFLAAVWHWVYWDL ELFRDPRTGEPALDLPKMFGIHLFLSGLLCFGFGAFHLTGLFGPGMWISDPYGVTGSVQP VAPEWGPDGFNPFNPGGVVAHHIAAGIVGIIAGLFHLTVRPPERLYKALRMGNIETVLSS SIAAVFFAAFVVAGTMWYGNATTPIELFGPTRYQWDQGYFHQEIERRVQSSVAQGASLSE AWSQIPEKLAFYDYVGNSPAKGGLFRTGPMVKGDGIAQSWQGHGVFKDAEGRELTVRRLP NFFETFPVILTDADGVVRADIPFRRAESKYSFEQSGVTVSFYGGDLDGKTFTDPADVKKY ARKAQGGEIFEFDRETLNSDGVFRTSPRGWFTFGHAVFALLFFFGHLWHGARTIYRDVFA GVEADLEEQVEWGLFQKVGDKSTRVRKEA
Uniprot No.

Target Background

Function
CP47 (Photosystem II chlorophyll apoprotein) is a key component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP production.
Database Links

KEGG: ana:all0138

STRING: 103690.all0138

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of CP47 (PsbB) in Photosystem II?

CP47, encoded by the psbB gene, is a core antenna protein of Photosystem II that plays a crucial role in light harvesting and energy transfer to the reaction center. The protein has been hypothesized to be involved in binding the reaction center chlorophyll, making it essential for the initial photochemistry in PSII . Studies involving gene interruption experiments demonstrate that an intact CP47 is required for a functional PSII complex, as insertion of a kanamycin resistance gene fragment into the psbB gene results in complete loss of Photosystem II activity . A distinguishing structural feature of CP47 is the presence of five pairs of histidine residues spaced by 13 or 14 amino acids located in hydrophobic regions of the protein, which are believed to be involved in chlorophyll binding . These histidine residues likely serve as ligands for the central magnesium atoms of chlorophyll molecules, positioning them optimally for efficient light absorption and energy transfer to the reaction center. The specific arrangement of these chlorophylls within CP47 is critical for its function as a light-harvesting antenna that funnels excitation energy toward the photochemical reaction center.

How conserved is the psbB gene across different photosynthetic organisms?

The psbB gene exhibits remarkable conservation across diverse photosynthetic organisms, reflecting its fundamental importance in photosynthesis. Sequence analysis has revealed that the DNA sequence of the psbB gene from the cyanobacterium Synechocystis 6803 shares 68% homology with that of spinach, while the predicted amino acid sequence shows even higher conservation at 76% homology . This greater protein sequence conservation compared to DNA sequence conservation suggests strong evolutionary pressure to maintain the functional structure of CP47. The hydropathy patterns of Synechocystis and spinach CP47 are almost indistinguishable, indicating the same general folding pattern in the thylakoid membrane across these evolutionarily distant species . This high degree of structural conservation is further supported by immunological evidence, as antibodies raised against CP47 show broad cross-reactivity across diverse photosynthetic organisms . According to antibody testing, CP47 proteins from organisms including cyanobacteria (Anabaena, Synechococcus, Synechocystis), algae (Chlamydomonas reinhardtii), bryophytes (Physcomitrium patens), diatoms (Opephora guenter-grassii, Skeletonema costatum), and higher plants (Arabidopsis thaliana, Hordeum vulgare, Oryza sativa) all share significant structural similarities . This extraordinary conservation across billions of years of evolutionary divergence underscores the critical importance of CP47's structure for photosynthetic function.

What techniques are commonly used to study CP47 protein expression and function?

Researchers employ a diverse toolkit of molecular, biochemical, and biophysical techniques to investigate CP47 expression and function. Gene cloning and DNA sequencing were initially used to determine the nucleotide and predicted amino acid sequences of the psbB gene from organisms like Synechocystis 6803, enabling comparative analyses across species . Site-directed mutagenesis has proven valuable for assessing the functional significance of specific CP47 residues, while gene interruption experiments (such as inserting a kanamycin resistance gene into psbB) have demonstrated the essential role of CP47 in PSII activity . For protein detection and quantification, Clear-native PAGE (CN-PAGE) and Western blot analysis using specific antibodies are commonly employed, with commercially available antibodies showing broad cross-reactivity across diverse photosynthetic organisms . Protein-protein interactions and complex formation can be studied using affinity purification techniques, as demonstrated by the use of histidine-tagged derivatives of CP47 and Psb28 with nickel-affinity chromatography . For functional studies, researchers use spectroscopic methods to assess light absorption, energy transfer, and electron transport activities. Radioactive labeling provides a powerful approach for tracking protein synthesis and turnover, as shown in studies examining how Psb28 deletion affects CP47 synthesis . Advanced structural techniques, particularly cryo-electron microscopy, have revealed detailed information about the three-dimensional organization of CP47 and its interactions with other PSII components and auxiliary factors .

What are the challenges in expressing recombinant CP47 protein, and how can they be overcome?

Expressing functional recombinant CP47 presents several significant challenges stemming from its complex structure and integration within the photosynthetic machinery. As a membrane protein with multiple transmembrane helices, CP47 requires specific cellular machinery for proper folding and membrane insertion. Additionally, CP47 binds multiple chlorophyll molecules via precisely positioned histidine residues, requiring coordination between protein synthesis and chlorophyll availability . Research indicates that successful CP47 synthesis depends on auxiliary factors like the conserved Pam68 protein, which acts early in CP47 biogenesis by binding to the apoprotein to promote chlorophyll incorporation . It has been proposed that Pam68 works in concert with membrane insertion factors like YidC and the assembly factor Ycf48 to position nascent CP47 in a conformation conducive to chlorophyll binding . This suggests that recombinant expression systems might require co-expression of these auxiliary factors to achieve proper CP47 folding and cofactor incorporation.

The synchronization of chlorophyll synthesis with CP47 expression represents another significant hurdle. Studies with psb28 deletion mutants have revealed limitations in CP47 synthesis accompanied by disruptions in chlorophyll biosynthesis, specifically at the cyclization step yielding the isocyclic ring E . This suggests an intimate coupling between CP47 production and chlorophyll availability that must be addressed in recombinant expression systems. To overcome these challenges, several methodological approaches can be implemented. Expression in photosynthetic hosts (cyanobacteria or algae) may provide the necessary machinery for chlorophyll synthesis and membrane protein assembly. Incorporating affinity tags, as demonstrated with histidine-tagged derivatives, facilitates purification while minimizing structural disruption . Co-expression with auxiliary factors like Pam68, YidC, Ycf48, and Psb28 might enhance proper folding and chlorophyll incorporation. For functional studies, in vitro reconstitution approaches could enable controlled assembly of CP47 with its pigments and interacting partners. Finally, expression of truncated or chimeric versions of CP47 might overcome some folding challenges while preserving regions of interest for specific research questions.

How do mutations in specific histidine residues of CP47 affect chlorophyll binding and PSII function?

CP47 contains five pairs of histidine residues spaced by 13 or 14 amino acids located in hydrophobic regions, which are believed to serve as ligands for chlorophyll molecules . Mutations in these histidine residues would be expected to disrupt chlorophyll binding, potentially altering the light-harvesting properties and energy transfer efficiency of PSII. While the search results don't provide direct experimental data on specific histidine mutations in CP47, we can infer their likely impact based on our understanding of chlorophyll-protein interactions and related studies on other photosynthetic complexes. Histidine residues typically coordinate the central magnesium atom of chlorophyll molecules, positioning them in precise orientations within the protein scaffold. Mutations that replace these histidines would likely alter or eliminate chlorophyll binding at specific sites, potentially creating gaps in the energy transfer network that connects the antenna system to the reaction center.

What is the role of CP47 in the assembly and repair of Photosystem II complexes?

CP47 plays a critical role in both the de novo assembly of PSII and its repair following photodamage, serving as a key building block in the stepwise construction of functional photosynthetic units. During initial PSII assembly, CP47 rapidly attaches to the reaction center II (RCII, comprising D1, D2, and cytochrome b559) to form the non-oxygen-evolving RC47 complex, a crucial intermediate in the biogenesis pathway . This binding occurs so efficiently that RCII is hardly detectable in vivo under optimal growth conditions . Biochemical analysis indicates that CP47 binds a virtually complete set of chlorophyll and β-carotene molecules at this stage, contributing substantially to the light-harvesting capacity of the developing complex . The formation of RC47 establishes a structural foundation for subsequent assembly steps, including the attachment of CP43 to create the PSII core complex (RCCII) and the addition of extrinsic proteins to form the oxygen-evolving complex.

In the context of PSII repair following photodamage, RC47 again represents a key intermediate. PSII is particularly susceptible to light-induced damage, especially to the D1 protein, necessitating a robust repair cycle to maintain photosynthetic function. During repair, damaged D1 is selectively removed and replaced while much of the PSII complex, including CP47, remains intact. RC47 complexes are relatively abundant in oxygenic phototrophs and represent a heterogeneous mixture formed during both assembly and repair processes . A subpopulation of RC47 containing early assembly factors like Ycf48, RubA, and CyanoP has been detected and may specifically represent PSII in the process of repair . While RC47 lacks the oxygen-evolving complex due to the absence of CP43 (which provides a glutamate ligand to the manganese cluster), these complexes maintain the capability for light-driven electron transfer from tyrosine Yz to the primary quinone acceptor QA .

Several auxiliary factors regulate CP47's role in PSII assembly and repair. The conserved Pam68 factor acts early in CP47 synthesis by binding to the apoprotein to promote chlorophyll incorporation . In chloroplasts, PAM68 works in concert with the DEAP2 factor, with the absence of both proteins resulting in complete loss of functional PSII . During stress conditions, CP47 associates with two Hlip (high light-inducible protein) heterodimers (HliA/C and HliB/C) that likely provide photoprotection to assembly intermediates . The recently discovered Psb35 subunit also binds to CP47-containing assembly intermediates, helping to stabilize Hlip binding and increase complex stability in the dark . These complex protein-protein interactions highlight the sophisticated regulatory network that governs CP47's role in PSII assembly and repair.

How does the interaction between CP47 and Psb28 regulate PSII biogenesis?

The interaction between CP47 and the Psb28 protein represents a fascinating regulatory mechanism in PSII biogenesis with implications for both assembly and photoprotection. Psb28 has been detected in both the RC47 complex (containing CP47 but lacking CP43) and in larger core complexes containing CP43 (RCCII) . Recent cryo-electron microscopy structures have revealed that D1, D2, and CP47 are the main interaction partners of Psb28, contrary to earlier proposals that it primarily contacted cytochrome b559 . The binding of Psb28 induces substantial structural changes to the cytoplasmic regions of D1 and D2, resulting in distortion of the QB binding pocket, alternative ligation of the non-heme iron by D2-Glu241 (rather than by bicarbonate as in oxygen-evolving PSII), and destabilization of CP43 binding . These conformational changes may serve important photoprotective functions by stabilizing reduced QA and reducing the production of damaging singlet oxygen from chlorophyll triplet states produced via charge recombination . Additionally, Psb28 attachment to the cytoplasmic surface of RC47 prevents docking of the phycobilisome light-harvesting antenna, further contributing to photoprotection by limiting light absorption during vulnerable assembly stages .

The physiological significance of the CP47-Psb28 interaction is complex and somewhat paradoxical. Surprisingly, levels of RC47 are almost undetectable in a psb28 null mutant of Synechocystis, and both assembly and repair appear to proceed faster than in wild-type cells . This counterintuitive finding suggests that Psb28 binding actually slows down PSII assembly by temporarily blocking progression beyond the RC47 stage (or RCCII with weakly bound CP43) . This regulatory checkpoint may serve specific functions, such as coordinating PSII assembly with chlorophyll biosynthesis. Indeed, psb28 deletion mutants exhibit slower autotrophic growth despite accelerated PSII assembly, along with limitations in CP47 synthesis and disruptions in chlorophyll biosynthesis . The mutant cells contain elevated levels of magnesium protoporphyrin IX methylester, decreased levels of protochlorophyllide, and release large quantities of protoporphyrin IX into the medium, indicating inhibition of chlorophyll biosynthesis at the cyclization step yielding the isocyclic ring E . These findings suggest that Psb28 binding to CP47-containing assembly intermediates helps coordinate protein synthesis with chlorophyll availability, ensuring that newly synthesized CP47 can be properly equipped with its full complement of chlorophyll molecules. This regulatory mechanism highlights the intricate coordination between protein synthesis, cofactor availability, and complex assembly in the biogenesis of photosynthetic machinery.

What experimental approaches can be used to study the temporal dynamics of CP47 incorporation into PSII complexes?

Investigating the temporal dynamics of CP47 incorporation into PSII complexes requires sophisticated experimental approaches that can track protein synthesis, assembly, and turnover with high temporal resolution. Pulse-chase radiolabeling represents a powerful technique for this purpose, allowing researchers to follow the fate of newly synthesized proteins through the assembly pathway. By briefly exposing cells to radioactive amino acids (typically 35S-methionine) followed by addition of excess unlabeled amino acids, researchers can create a synchronized cohort of labeled proteins whose progress through assembly can be monitored over time . At various time points after labeling, protein complexes can be isolated and separated by techniques like blue native gel electrophoresis or sucrose gradient centrifugation, allowing visualization of labeled CP47 in different assembly states (unassembled, RC47, PSII monomer, PSII dimer). This approach has been used successfully to reveal limitations in CP47 synthesis in psb28 deletion mutants .

Inducible gene expression systems provide another valuable approach for studying assembly dynamics. By placing the psbB gene under control of an inducible promoter in a psbB deletion background, researchers can trigger CP47 synthesis at a defined time point and monitor subsequent assembly steps. This strategy can be combined with time-resolved proteomics to identify proteins that transiently associate with CP47 during different assembly stages. Specifically, CP47 complexes could be immunoprecipitated or affinity-purified at various times after induction, and co-purifying proteins identified by mass spectrometry. This approach could reveal the sequence and timing of interactions with assembly factors like Pam68, Ycf48, and Psb28, as well as with other PSII subunits.

Chlorophyll fluorescence measurements provide real-time insights into the functional consequences of CP47 incorporation. Parameters like ΦPSII (quantum yield of PSII), NPQ (non-photochemical quenching), and FV/FM (maximum quantum efficiency) reflect different aspects of PSII function that change as assembly proceeds. By measuring these parameters at intervals after inducing CP47 synthesis, researchers can determine when newly synthesized CP47 contributes to functional PSII. Time-resolved fluorescence spectroscopy offers even more detailed information about energy transfer processes within PSII, potentially revealing the progressive optimization of light harvesting as CP47 is correctly incorporated with its full complement of chlorophylls.

For single-cell or subcellular resolution, fluorescence microscopy approaches can be valuable. Fusion of fluorescent proteins to CP47 (though challenging due to potential interference with function) could allow direct visualization of its movement and incorporation into PSII complexes. Alternatively, immunofluorescence with specific antibodies against CP47 at different time points after induction could reveal changes in its localization and organization. Advanced techniques like fluorescence recovery after photobleaching (FRAP) or single-molecule tracking could provide unprecedented insights into the mobility and dynamics of CP47 during PSII assembly, though these approaches would require development of minimally disruptive fluorescent tagging strategies.

How can structural studies of CP47 inform bioengineering efforts to optimize photosynthesis?

Structural studies of CP47 provide a crucial foundation for rational bioengineering approaches aimed at enhancing photosynthetic efficiency and robustness. By revealing the precise three-dimensional arrangement of CP47 and its interactions with pigments and other proteins, these studies identify specific targets for modification to improve light harvesting, energy transfer, and photoprotection. The remarkably conserved folding pattern of CP47 across diverse photosynthetic organisms, as evidenced by nearly identical hydropathy profiles between cyanobacterial and plant versions , suggests both evolutionary optimization and potential transferability of engineering strategies across species. This conservation provides confidence that structural insights gained from model organisms like Synechocystis can inform engineering efforts in crop plants or algal biofuel producers.

The histidine residues in CP47 that coordinate chlorophyll molecules represent particularly promising targets for bioengineering. CP47 contains five pairs of histidines spaced by 13 or 14 amino acids in hydrophobic regions , which likely serve as ligands for chlorophyll molecules. Strategic modification of these residues or introduction of additional histidines at carefully selected positions could potentially alter the number, positioning, or types of chlorophyll molecules bound by CP47. Such modifications might expand the spectral range of light absorption, optimize excitation energy transfer to the reaction center, or enhance photoprotection mechanisms. For example, introducing binding sites for chlorophylls with red-shifted absorption properties could improve utilization of far-red light that is normally poorly absorbed by photosynthetic organisms, potentially increasing light-use efficiency in dense plant canopies or bioreactors.

Structural studies have also revealed important interactions between CP47 and various auxiliary proteins that influence PSII assembly, function, and repair. The binding of Psb28 to CP47 and other PSII components induces conformational changes that may protect against photodamage by stabilizing reduced QA and reducing singlet oxygen production . Understanding these interactions at the molecular level could guide efforts to enhance PSII stability under stress conditions, potentially by strengthening beneficial protein-protein interactions or introducing novel ones. Similarly, knowledge of how the PsbH protein interacts with CP47 to help bind chlorophyll and β-carotene could inform strategies to optimize pigment incorporation and stability in engineered photosystems.

The dynamic process of PSII assembly and repair represents another target for optimization based on structural insights. CP47 forms part of the RC47 complex, a key intermediate in both PSII biogenesis and repair following photodamage . Structural understanding of how auxiliary factors like Pam68 promote chlorophyll binding to CP47 could inspire approaches to accelerate PSII repair or enhance assembly efficiency. The finding that Psb28 appears to slow down PSII assembly, possibly to coordinate it with chlorophyll availability , suggests that modulating the expression or activity of such regulatory factors could be a means to balance assembly speed with quality control according to specific applications or environmental conditions. Combined with advances in synthetic biology and protein engineering, these structure-based insights offer promising avenues to enhance photosynthetic performance for both basic research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.