Recombinant Nostoc sp. Photosystem Q (B) protein 1

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA1; psbA-1; psbAI; alr4866; Photosystem II protein D1 1; PSII D1 protein 1; 32 kDa thylakoid membrane protein 1; Photosystem II Q(B protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
psbA1
Target Protein Sequence
MTTTLQQRSSANVWERFCTWITSTENRIYVGWFGVLMIPTLLAATVCFIIAFVAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL IGCACYLGRQWELSYRLGMRPWICVAYSAPLASATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEIESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: ana:alr4866

STRING: 103690.alr4866

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Nostoc sp. Photosystem Q(B) protein 1 and what is its biological significance?

Recombinant Nostoc sp. Photosystem Q(B) protein 1 (also known as Photosystem II protein D1 1 or 32 kDa thylakoid membrane protein 1) is a recombinantly expressed version of the D1 protein found in the photosystem II complex of Nostoc sp. (strain PCC 7120 / UTEX 2576). It is encoded by the psbA1 gene (also called psbA-1 or psbAI, with locus name alr4866) . This protein is essential for photosynthetic electron transport, functioning as part of the reaction center that binds plastoquinone during the electron transfer process. The D1 protein is particularly important because it exhibits fast, light-dependent turnover that is related to the repair of photo-inactivated PSII complexes, making it crucial for maintaining photosynthetic efficiency under varying light conditions .

How should Recombinant Nostoc sp. Photosystem Q(B) protein 1 be stored and handled for optimal stability?

For optimal stability, Recombinant Nostoc sp. Photosystem Q(B) protein 1 should be stored in a Tris-based buffer with 50% glycerol at -20°C. For extended storage periods, conservation at -20°C or -80°C is recommended. Repeated freezing and thawing should be avoided as this can compromise protein integrity and function. For working stocks, aliquots can be stored at 4°C for up to one week . When handling the protein, it's advisable to work quickly on ice to minimize exposure to room temperature, which can accelerate protein degradation. Researchers should also consider adding protease inhibitors when working with the protein to prevent enzymatic degradation.

What techniques are commonly used to detect and quantify Recombinant Nostoc sp. Photosystem Q(B) protein 1?

Several techniques are commonly employed to detect and quantify Recombinant Nostoc sp. Photosystem Q(B) protein 1. Enzyme-Linked Immunosorbent Assay (ELISA) is widely used for quantitative detection, utilizing specific antibodies against the protein . Western blotting is another standard method that allows for both detection and semi-quantitative analysis of the protein, particularly useful when examining expression levels under different conditions. Mass spectrometry-based proteomic approaches have also been applied to study this protein in the context of comprehensive proteomic analyses of Nostoc sp., especially when investigating environmental stressor effects . Fluorescence-based techniques, such as using GFP-tagged constructs, can be employed for tracking protein localization and dynamics in vivo. Circular dichroism spectroscopy may be used to assess protein folding and secondary structure characteristics after purification.

How do genetic variants in the psbA gene affect the structure and function of Photosystem Q(B) protein in Nostoc sp.?

Genetic variants in the psbA gene have been observed to cause both synonymous and non-synonymous changes in the Photosystem Q(B) protein (PsbA) structure, with potential impacts on its function. Research has shown that different environmental conditions can lead to specific patterns of variants in this gene. For instance, studies of Nostoc sp. exposed to space conditions revealed that UV exposure on the International Space Station (ISS) resulted in different variants compared to samples kept in the dark or exposed to UV on Earth .

Interestingly, for samples on the ISS, non-synonymous variants of the protein occurred in samples kept in the dark, but not in those that experienced UV exposure. This suggests that the combinatorial nature of ionizing cosmic and UV radiations in space environments may not have the same effect as each type of radiation alone. Multiple variants emerged in the PsbA protein in samples on the ground exposed to UV radiation, possibly due to higher UV radiation levels .

What methodologies are most effective for studying protein-protein interactions involving Photosystem Q(B) protein 1?

For studying protein-protein interactions involving Photosystem Q(B) protein 1, several methodologies have proven particularly effective. Co-immunoprecipitation (Co-IP) coupled with mass spectrometry can identify interaction partners by pulling down protein complexes using specific antibodies against PsbA1. Yeast two-hybrid (Y2H) systems, though challenging for membrane proteins, can be adapted using modified approaches such as split-ubiquitin Y2H for membrane protein interactions.

Förster Resonance Energy Transfer (FRET) and Bimolecular Fluorescence Complementation (BiFC) offer in vivo visualization of protein interactions, allowing researchers to observe dynamic interactions in real-time within cyanobacterial cells. Crosslinking mass spectrometry (XL-MS) can capture transient interactions by chemically linking proteins that are in close proximity before analysis.

In silico analysis has revealed a comparatively smaller interactome for Nostoc proteins compared to other bacteria, suggesting specialized interaction networks . When designing interaction studies, it's important to consider the membrane-embedded nature of the PsbA1 protein and the need for appropriate detergents for solubilization without disrupting native interactions. Additionally, researchers should account for potential light-dependent interactions, as photosynthetic protein interactions may change under different light conditions.

How does the expression and turnover of Photosystem Q(B) protein 1 respond to environmental stressors in Nostoc sp.?

The expression and turnover of Photosystem Q(B) protein 1 in Nostoc sp. exhibits complex responses to environmental stressors. Studies have shown that various stress conditions can induce differential expression patterns of photosystem components, including the D1 protein . The D1 protein is known for its rapid turnover, which is typically related to the repair of photo-inactivated PSII complexes, suggesting it plays a crucial role in adaptation to changing environmental conditions.

Research examining Nostoc sp. exposed to space conditions revealed that UV radiation and cosmic radiation can induce specific patterns of variants in photosynthesis-related genes, including psbA . Interestingly, the combinatorial effects of different types of radiation may not be simply additive, as demonstrated by the different variants observed in samples exposed to UV on the ISS versus those kept in the dark or exposed to UV on Earth.

The high radioresistance of Nostoc sp. strain PCC7120 suggests robust DNA repair pathways that may influence protein expression and turnover under stress conditions . Studies have shown that stressors can affect not only the D1 protein directly but also the broader nitrogen and carbon metabolic pathways, which are tightly co-regulated in cyanobacteria cells . This interconnection may explain how environmental stressors can have cascading effects on photosystem protein expression and function.

How can researchers effectively purify functional Photosystem Q(B) protein 1 for structural studies?

Purifying functional Photosystem Q(B) protein 1 for structural studies presents several challenges due to its hydrophobic nature and membrane integration. An effective purification protocol begins with optimized cell lysis using methods that preserve protein structure, such as gentle mechanical disruption in the presence of appropriate detergents and protease inhibitors.

For membrane protein extraction, a two-phase solubilization approach is recommended, first using a mild detergent (such as n-dodecyl β-D-maltoside or digitonin) to isolate thylakoid membranes, followed by a second solubilization step to extract the protein of interest. Affinity chromatography using recombinant tags (such as His-tag or FLAG-tag) can be employed for specific purification, though care must be taken regarding tag placement to avoid interfering with protein function.

Size exclusion chromatography is valuable for separating the protein of interest from aggregates and other impurities while maintaining the native oligomeric state. Throughout the purification process, it's critical to protect the sample from light exposure when possible and maintain reducing conditions to prevent oxidative damage.

For structural studies specifically, researchers should consider:

  • Assessing protein homogeneity using analytical techniques like dynamic light scattering

  • Performing stability screening to identify optimal buffer conditions

  • Using circular dichroism to verify proper folding before crystallization attempts

  • For cryo-EM studies, optimizing grid preparation to prevent preferred orientation issues

  • For X-ray crystallography, screening various detergents and lipid additives to promote crystal formation

The purified protein should be validated for functionality using activity assays specific to the electron transport capabilities of the D1 protein, such as oxygen evolution measurements or electron transfer assays.

What are the key factors to consider when designing experiments to study genetic variants of psbA in Nostoc sp.?

When designing experiments to study genetic variants of psbA in Nostoc sp., researchers should consider several key factors to ensure robust and meaningful results. First, experimental conditions must be carefully controlled and documented, including light intensity, temperature, and growth media composition, as these factors can influence gene expression and variant formation. Recent studies have shown that different environmental conditions can lead to specific patterns of variants in photosynthesis-related genes .

Sample collection and processing protocols should be standardized to minimize contamination, which has been observed at varying levels depending on growth media (ranging from 40.3% to 82.8% sample purity) . For genetic analysis, researchers should employ high-coverage sequencing approaches to ensure detection of variants. Single-cell sequencing techniques, such as those using microfluidic platforms for single-cell whole genome amplification (SC-WGA), have proven effective for identifying genomic changes in individual Nostoc cells .

To minimize artifacts or errors in variant calling, it is advisable to require that the same exact genomic variant be present in at least two biological replicates exposed to the same condition . When analyzing variants, researchers should consider both synonymous and non-synonymous changes, as both can have biological significance. The Ka/Ks ratio (the fraction of non-synonymous variants to synonymous variants) can provide insights into selective pressures acting on the gene .

Protein structure prediction tools (such as RaptorX Structure Prediction) can be valuable for assessing the potential impact of non-synonymous variants on protein structure and function . Additionally, phenotypic characterization following genetic analysis is important for correlating genetic changes with functional outcomes, as demonstrated by colony-forming and growth experiments performed after exposure to different environmental conditions .

How can researchers effectively compare Photosystem Q(B) protein expression and modification across different environmental conditions?

To effectively compare Photosystem Q(B) protein expression and modification across different environmental conditions, researchers should implement a comprehensive experimental approach. Proteomic analysis using techniques such as liquid chromatography-tandem mass spectrometry (LC-MS/MS) allows for quantitative comparison of protein abundance across conditions, as demonstrated in studies of Nostoc sp. PCC 7120 under various stressors .

For accurate comparisons, experimental designs should include appropriate controls and multiple biological replicates for each condition. Standardized extraction and sample preparation protocols are essential to minimize technical variability. When studying post-translational modifications (PTMs), enrichment techniques specific to the modification of interest (e.g., phosphorylation, oxidation) should be incorporated to enhance detection sensitivity.

Western blotting with specific antibodies against Photosystem Q(B) protein 1 can provide complementary data on protein abundance and can detect specific modifications when using modification-specific antibodies. For functional assessment, researchers can measure photosynthetic activity parameters such as oxygen evolution, electron transport rates, or chlorophyll fluorescence across conditions to correlate protein changes with functional outcomes.

Data analysis should employ appropriate statistical methods for comparing protein expression levels across conditions, including normalization techniques to account for total protein content differences. Multivariate statistical approaches can help identify patterns of changes across multiple proteins in the photosynthetic apparatus. Integration of proteomic data with transcriptomic data can provide insights into regulatory mechanisms controlling protein expression under different conditions.

To visualize protein modifications and structural changes, techniques such as tertiary structure protein prediction and structural alignment (using tools like PyMOL) have been successfully employed to examine the effects of variants across experimental conditions .

What control measures should be implemented when studying recombinant Photosystem Q(B) protein to ensure reproducibility?

To ensure reproducibility when studying recombinant Photosystem Q(B) protein, researchers should implement several critical control measures throughout their experimental workflow. During expression and purification, researchers should verify protein identity using mass spectrometry and confirm the full amino acid sequence, as variations can significantly impact functionality . Western blot analysis with specific antibodies should be performed to confirm protein size and purity.

Quality control testing should include assessing protein concentration using multiple methods (e.g., Bradford assay, BCA assay, and absorbance at 280 nm) for verification. SDS-PAGE analysis of each purification batch is essential to document protein purity and detect any degradation products. For functional validation, appropriate activity assays specific to D1 protein function should be conducted to ensure that the recombinant protein retains its native activity.

Storage conditions must be strictly controlled and documented, maintaining the protein in recommended buffer conditions (Tris-based buffer with 50% glycerol) at appropriate temperatures (-20°C or -80°C for long-term storage) . Aliquoting of proteins to avoid repeated freeze-thaw cycles is crucial for maintaining protein integrity.

For experimental reproducibility, detailed documentation of all experimental parameters is essential, including expression system details, purification protocol specifics, buffer compositions, and handling procedures. When conducting comparative studies, researchers should use proteins from the same purification batch whenever possible, or thoroughly characterize different batches to account for batch-to-batch variation.

Positive and negative controls should be included in all experiments to validate assay performance. For instance, when studying protein-protein interactions, known interaction partners and non-interacting proteins should be included as controls. Additionally, researchers should establish clear acceptance criteria for experimental results and include appropriate technical and biological replicates in experimental designs.

How should researchers analyze structural changes in Photosystem Q(B) protein resulting from genetic variants?

Analysis of structural changes in Photosystem Q(B) protein resulting from genetic variants requires a multi-faceted approach combining computational prediction with experimental validation. Initially, researchers should conduct sequence analysis to identify and catalog all variants (both synonymous and non-synonymous) in the psbA gene across experimental conditions. For each non-synonymous variant, the specific amino acid change and its location within the protein should be documented .

Tertiary structure prediction using tools such as RaptorX Structure Prediction server has proven effective for predicting protein structures based on amino acid sequences obtained under different experimental conditions . The predicted structures should be returned in PDB format for further analysis. Structural pairwise alignment using visualization software like PyMOL v2.3.0 allows for detailed comparison of structures from different conditions, highlighting regions of structural deviation .

Researchers should pay particular attention to:

  • Effects of variants on functional domains and active sites

  • Changes in surface residues that might affect protein-protein interactions

  • Alterations in transmembrane regions that could impact membrane integration

  • Modifications to cofactor binding sites that might influence electron transfer

To comprehensively visualize the effects of variants, structural differences and non-synonymous variants should be examined in the context of the protein's tertiary structure . This approach can reveal whether variants cluster in specific functional regions or are distributed throughout the protein. Additionally, molecular dynamics simulations can provide insights into how structural changes might affect protein flexibility and dynamics in a membrane environment.

The structural analysis should be complemented with experimental validation when possible, such as circular dichroism to assess changes in secondary structure, or functional assays to determine whether structural changes correlate with altered photosynthetic activity. This combined computational-experimental approach provides the most comprehensive understanding of how genetic variants impact Photosystem Q(B) protein structure and function.

What statistical approaches are most appropriate for analyzing differential expression of Photosystem II components under various conditions?

For analyzing differential expression of Photosystem II components under various conditions, several statistical approaches can be employed depending on the experimental design and data type. When analyzing protein expression data from proteomic studies, normalization is a critical first step to account for technical variability and differences in total protein loading. Common normalization methods include total intensity normalization, median normalization, or normalization to housekeeping proteins that maintain stable expression across conditions .

For comparing expression levels across multiple conditions, Analysis of Variance (ANOVA) is appropriate when more than two conditions are being examined, while t-tests (paired or unpaired depending on the experimental design) can be used for two-condition comparisons. When dealing with non-normally distributed data, non-parametric alternatives such as the Kruskal-Wallis test or Mann-Whitney U test should be employed.

Multiple testing correction is essential when analyzing expression data for numerous proteins simultaneously to control the false discovery rate (FDR). Common approaches include the Benjamini-Hochberg procedure or Bonferroni correction, with the former generally preferred for genomic and proteomic datasets due to its less stringent nature.

When integrating data across multiple levels (e.g., transcriptomic and proteomic), methods such as Canonical Correlation Analysis (CCA) or Orthogonal Partial Least Squares (O-PLS) can help identify relationships between different data types. For time-course experiments, repeated measures ANOVA or linear mixed models are appropriate for capturing temporal dynamics of expression changes.

Statistical power analysis should be conducted during experimental design to determine appropriate sample sizes needed to detect biologically meaningful differences in expression levels with statistical confidence.

How can researchers effectively integrate genomic, proteomic, and functional data when studying Photosystem Q(B) protein in Nostoc sp.?

Effective integration of genomic, proteomic, and functional data when studying Photosystem Q(B) protein requires a systematic multi-omics approach. Researchers should begin by establishing a common experimental design that allows sampling for different analyses from the same biological material whenever possible, ensuring direct comparability across data types. Standardized metadata collection is essential for all experiments, documenting environmental conditions, growth parameters, and sampling procedures .

For data integration, researchers can employ several strategies:

  • Correlation-based approaches: Calculating correlation coefficients between genomic variants, protein expression levels, and functional parameters can identify relationships across data types. For example, correlating specific psbA variants with changes in D1 protein abundance and photosynthetic efficiency measurements.

  • Pathway analysis: Mapping data to known photosynthetic and metabolic pathways can provide context for interpreting changes. Tools like KEGG or BioCyc can help visualize how changes in one data type affect related components across pathways.

  • Network analysis: Constructing interaction networks that incorporate protein-protein interactions, genetic interactions, and functional relationships can reveal how perturbations propagate through the photosynthetic system. This is particularly relevant given the findings of a comparatively smaller interactome for Nostoc proteins compared to other bacteria .

  • Machine learning approaches: Supervised or unsupervised learning algorithms can identify patterns across heterogeneous data types and potentially predict functional outcomes based on genomic or proteomic profiles.

  • Visualization techniques: Integrated visualization tools like Circos plots or heatmaps can display relationships between different data types, helping researchers identify patterns that might not be apparent when examining each data type individually.

When interpreting integrated data, researchers should consider the temporal aspects of different processes. For instance, genetic variants occur first, followed by changes in transcription, translation, and protein modification, ultimately leading to functional effects. The timing of these processes may not be synchronized, and lag effects should be considered when interpreting results.

Additionally, researchers should implement validation experiments to confirm key findings from integrated analyses, such as site-directed mutagenesis to verify the impact of specific variants on protein function, or targeted protein expression studies to confirm proteomic findings .

What are the current research gaps in understanding Photosystem Q(B) protein 1 in Nostoc sp.?

Despite significant advances in understanding the Photosystem Q(B) protein 1 in Nostoc sp., several research gaps remain. The complete interactome of PsbA1 in Nostoc sp. has not been fully characterized, with studies suggesting a comparatively smaller interactome compared to other bacteria . This raises questions about the specific protein-protein interactions that regulate D1 function in this organism. The mechanisms underlying the differential expression of psbA genes under various environmental conditions are not fully understood, particularly how regulatory networks control gene expression in response to stressors.

While genetic variants in the psbA gene have been observed under different environmental conditions, the functional significance of many of these variants, especially synonymous changes, remains unclear . Additionally, the temporal dynamics of D1 protein turnover and replacement in Nostoc sp. have not been comprehensively documented, particularly under fluctuating environmental conditions. The potential role of post-translational modifications in regulating D1 protein function in Nostoc sp. also represents a significant knowledge gap, as these modifications could play critical roles in adaptation to environmental changes.

The structure-function relationships for specific regions of the D1 protein in Nostoc sp. have not been fully elucidated through experimental approaches like site-directed mutagenesis. There is also limited understanding of how D1 variants might affect the assembly and stability of the complete photosystem II complex in Nostoc sp. The specific adaptation mechanisms that allow Nostoc sp. to maintain photosynthetic efficiency under extreme conditions, such as space environments or high UV radiation, warrant further investigation .

Finally, comparative studies across different cyanobacterial species are needed to understand the evolutionary conservation and divergence of D1 protein function and regulation. Addressing these research gaps would significantly advance our understanding of photosynthetic processes in Nostoc sp. and potentially inform applications in biotechnology and astrobiology.

How might advances in understanding Photosystem Q(B) protein 1 contribute to broader research applications?

Advances in understanding Photosystem Q(B) protein 1 in Nostoc sp. have significant potential to contribute to broader research applications across multiple fields. In biotechnology, deeper knowledge of D1 protein structure and function could enable the engineering of photosynthetic organisms with enhanced stress tolerance or improved photosynthetic efficiency. This could lead to the development of cyanobacterial strains optimized for biofuel production or carbon capture applications.

For astrobiology and space biology, understanding how the D1 protein adapts to extreme conditions provides insights into the limits of photosynthetic life and potential adaptation mechanisms for survival in harsh environments . This knowledge could inform the search for extraterrestrial life and the development of bio-regenerative systems for long-duration space missions. The non-random nature of genetic alterations observed in the psbA gene under space conditions challenges traditional views of random mutation landscapes, suggesting directed adaptation mechanisms that could have broader implications for evolutionary biology .

In synthetic biology, detailed structural and functional knowledge of the D1 protein could enable the design of artificial photosynthetic systems or hybrid systems combining biological and artificial components for energy capture and conversion. Agricultural applications might benefit from transferring stress-tolerance mechanisms from Nostoc sp. to crop plants, potentially improving resilience to environmental stressors like UV radiation or drought.

Environmental monitoring applications could utilize engineered biosensors based on D1 protein responses to specific stressors, providing sensitive tools for detecting environmental changes or contaminants. The protein repair and replacement mechanisms in Nostoc sp. might also provide insights for developing novel approaches to protein stabilization in biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.