Recombinant Nostoc sp. Photosystem Q (B) protein 2

Shipped with Ice Packs
In Stock

Description

Enhanced PSII Repair Under Stress Conditions

One of the most significant functions of the Recombinant Nostoc sp. Photosystem Q (B) protein 2 is its involvement in PSII repair mechanisms. Research demonstrates that this protein plays a crucial role in maintaining PSII activity under dehydration conditions in Nostoc flagelliforme . This function is particularly important considering that PSII is highly susceptible to damage under various stress conditions, including high light intensity and dehydration.

The repair of damaged PSII proceeds in two primary steps: first, damaged D1 protein is removed (e.g., by FtsH and Deg proteases), and then newly synthesized D1 protein is integrated into its place . The DnaK2-DnaJ9 chaperone pair facilitates this process by enhancing the activity of FtsH2 protease, which is involved in D1 turnover by degrading damaged D1 protein .

Experimental Evidence from Heterologous Expression

Since genetic manipulation is difficult in Nostoc flagelliforme, researchers have employed heterologous expression of NfdnaK2 in Nostoc sp. PCC 7120 to investigate its function in PSII repair and protection. The results have been compelling, demonstrating enhanced PSII repair in transgenic strains expressing NfDnaK2 .

PSII activity probed by O₂ evolution rate also supported enhanced PSII repair in the OE-NfdnaK2 strain when compared with the wild-type strain, providing additional evidence for the protein's role in photosynthetic repair mechanisms .

Chaperone Activity and Protein Interactions

The Recombinant Nostoc sp. Photosystem Q (B) protein 2 functions as part of a chaperone system, working in conjunction with DnaJ-like proteins to specify its functions. This association appears to be conserved in both cyanobacteria and vascular plants . The specific protein interactions involve NfDnaK2 forming a functional chaperone pair with NfDnaJ9 in Nostoc flagelliforme .

Since chaperones function in folding and assembly of newly synthesized proteins, the NfDnaK2-NfDnaJ9 chaperone pair may facilitate the folding, maturation, and accumulation of NfFtsH2 protease in the thylakoid membrane . This is supported by evidence showing that the content of FtsH2 was significantly increased (by 65%) in the membrane fractions of OE-NfdnaK2 Nostoc sp. PCC 7120 when compared with that of the wild-type strain .

Role in D1 Protein Degradation

The D1 protein degradation rates were compared between wild-type and transgenic strains exposed to high light conditions with the addition of protein synthesis inhibitor lincomycin. The results showed that while the degradation of D1 protein started within 20 minutes of high-light treatment in both strains, the degradation proceeded much faster in the transgenic strain than in the wild-type strain .

After 60 minutes of exposure to high light, the D1 signal was very weak in the transgenic strain, while there was still a clearly detectable amount of damaged D1 in the wild-type Nostoc sp. PCC 7120 . This provides direct evidence linking the DnaK2-DnaJ chaperone system with the degradation of D1 proteins during the PSII repair cycle, a critical process for maintaining photosynthetic efficiency under stress conditions .

Transcriptional Control

The expression of the Recombinant Nostoc sp. Photosystem Q (B) protein 2 is regulated at the transcriptional level by specific transcription factors. Two transcription factors capable of binding to the promoter region of NfdnaK2 have been identified: NfRre1 (COO91_05451) and NfPedR (COO91_04806) .

The interactions between these transcription factors and the NfdnaK2 promoter have been verified through electrophoretic mobility shift assay (EMSA). Retarded DNA bands were observed for biotin-labeled promoter fragments after addition of recombinant GST-tagged NfRre1 or NfPedR, with the amount of retarded DNA bands increasing with higher concentrations of the transcription factors .

Both NfRre1 and NfPedR contain an N-terminal receiver domain and a C-terminal DNA-binding domain and belong to the NarL/FixJ family of transcription factors . The transcriptional response pattern of these two transcription factors to drought, especially that of NfRre1, coincided with that of NfdnaK2, suggesting that NfRre1 and NfPedR act as positive regulators of the expression of NfdnaK2 in response to drought stress in Nostoc flagelliforme .

Response to Environmental Stressors

The expression of this protein is particularly responsive to environmental stress conditions, especially dehydration and high light intensity. This responsive regulation enables Nostoc species to adapt to changing environmental conditions by enhancing their photosynthetic repair mechanisms when needed .

Photosystem Proteins in Nostoc sp. PCC 7120

Proteomic studies have identified several photosystem-related proteins in Nostoc sp. PCC 7120, providing context for understanding the role of Recombinant Nostoc sp. Photosystem Q (B) protein 2 within the broader photosynthetic machinery. Table 1 presents a selection of photosystem-related proteins identified in Nostoc sp. PCC 7120.

Table 1: Photosystem-Related Proteins in Nostoc sp. PCC 7120

No.ProteinGene IDFunctionFold Change (BMAA/Control)p-value
1psbW photosystem II 13kDa proteinall0801photosystem IIFound only in BMAA treated sample0.04
2petE plastocyaninall0258plastocyanin0.580.06
3cpcA phycocyanin alpha chainalr0529phycocyanin0.560.075
4apcD allophycocyanin B alpha chainall3653allophycocyanin0.820.076
5psaB photosystem I P700 chlorophyll a apoprotein A2alr5155photosystem I0.260.08
6psaF photosystem I subunit IIIall0109photosystem I0.610.04

The proteomic analysis reveals that treatment with β-N-methylamino-L-alanine (BMAA) affects the expression of various photosystem-related proteins in Nostoc sp. PCC 7120, highlighting the sensitivity of the photosynthetic apparatus to environmental stressors .

Nucleotide Metabolism Proteins

The function of photosystem proteins, including the Recombinant Nostoc sp. Photosystem Q (B) protein 2, is intrinsically linked to nucleotide metabolism. Table 2 presents nucleotide metabolism proteins identified in Nostoc sp. PCC 7120.

Table 2: Nucleotide Metabolism Proteins in Nostoc sp. PCC 7120

No.EnzymeGene IDMetabolic PathwayFold Change (BMAA/Control)p-value
1EC:2.7.4.6 nucleoside diphosphate kinasealr3402transferring phosphorus-containing groups0.750.004
2EC:2.1.2.2 phosphoribosylglycinamide formyltransferase-2alr1299purine metabolism2.140.05
3EC:2.1.2.3 3.5.4.10 purH; bifunctional purine biosynthesis proteinall3093purine metabolism0.710.08
4EC:1.1.1.205 inosine 5-monophosphate dehydrogenasealr0051purine metabolism1.750.00013

This table illustrates the interconnected nature of nucleotide metabolism and photosynthetic processes in Nostoc sp. PCC 7120, which provides context for understanding the broader metabolic network in which the Recombinant Nostoc sp. Photosystem Q (B) protein 2 functions .

Electron Transfer Mechanisms Related to Photosystem Function

The function of photosystem proteins, including the Recombinant Nostoc sp. Photosystem Q (B) protein 2, is integrated with electron transfer mechanisms involving cytochrome complexes. While not directly focusing on Nostoc sp., studies on related cyanobacteria provide insights into these mechanisms.

In oxygenic photosynthesis, the cytochrome b₆f complex links the linear electron transfer reactions occurring at photosystems I and II and generates a transmembrane proton gradient via the Q-cycle . This complex plays a central role in linear electron transfer and participates in a range of processes including cyclic electron transfer, state transitions, and photosynthetic control .

The regulatory roles of cytochrome b₆f are facilitated by auxiliary proteins that differ depending upon the species. In cyanobacteria, PetP appears to be a key player in the regulatory balance between linear and cyclic electron transfer . The cytochrome b₆f complex uses the Q-cycle to couple electron transfer between the PSII electron acceptor plastoquinol (PQH₂) and the PSI electron donor plastocyanin (or cytochrome c₆ in some cyanobacteria) to proton transfer across the membrane, conserving energy as a proton motive force for ATP synthesis .

Understanding these electron transfer mechanisms provides a broader context for the role of photosystem proteins in maintaining photosynthetic efficiency, especially under stress conditions where repair mechanisms become critical.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing your order, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
psbA2; psbA-2; psbAII; alr3727; psbA3; psbA-3; psbAIII; alr4592; psbA4; psbA-4; psbAIV; all3572; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
psbA2
Target Protein Sequence
MTATLQQRKSANVWEQFCEWITSTNNRLYIGWFGVLMIPTLLAATTCFIIAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL TGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, producing O(2) and a proton gradient which is subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: ana:all3572

STRING: 103690.alr4592

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of DnaK2 chaperone in Photosystem II repair in Nostoc species?

The DnaK2 chaperone plays a critical role in maintaining PSII activity, particularly under stress conditions such as dehydration. Research indicates that NfDnaK2 is involved in PSII repair through mediating the degradation of damaged D1 proteins. The repair process occurs in two steps: first, damaged D1 protein is removed (by proteins like FtsH and Deg), and then newly synthesized D1 protein is integrated into its place. The NfDnaK2-NfDnaJ9 chaperone pair likely facilitates the folding, maturation, and accumulation of NfFtsH2 protease in the thylakoid membrane, which in turn promotes the degradation of damaged D1 during the PSII repair cycle .

How do cyanobacterial species like Nostoc maintain photosynthetic activity under stress conditions?

Cyanobacteria like Nostoc flagelliforme have evolved specialized mechanisms to maintain photosynthetic activity under extreme conditions such as dehydration. These organisms employ molecular chaperones like DnaK2 that work with co-chaperones (J-domain proteins) to maintain the functionality of photosynthetic apparatus. Under stress conditions, the expression of these chaperones is upregulated through specialized transcription factors like NfRre1 and NfPedR, which bind to promoter regions of genes like NfdnaK2. This stress-responsive expression pattern allows for rapid repair of photosystem components, particularly the D1 protein of PSII, which is highly susceptible to damage .

What is the significance of phycobilisome attachment to Photosystem II in cyanobacteria?

Phycobilisomes (PBS) serve as the primary light-harvesting complexes in cyanobacteria, capturing light energy and transferring it to photosynthetic reaction centers. The proper attachment of PBS to Photosystem II is critical for efficient photosynthesis. Recent research has identified a linker protein (LcpA) that, together with the PB-loop, is responsible for the attachment of PBS to PSII in cyanobacteria. This attachment mechanism ensures optimal energy transfer from light-harvesting complexes to reaction centers, thereby maximizing photosynthetic efficiency under various light conditions .

How does heterologous expression of NfDnaK2 affect PSII repair mechanisms in different Nostoc strains?

Heterologous expression of NfDnaK2 from Nostoc flagelliforme in Nostoc sp. PCC 7120 significantly enhances PSII repair mechanisms. Comparative analysis of maximum potential quantum efficiency of PSII (Fv/Fm values) under high light stress (400 μmol photons m⁻² s⁻¹) reveals that transgenic strains expressing NfDnaK2 maintain higher PSII activity than wild-type strains. When protein synthesis is inhibited by lincomycin, both strains show similar decreases in Fv/Fm values, confirming that the observed difference is due to enhanced repair rather than protection from damage. Oxygen evolution measurements further corroborate these findings, showing higher PSII activity in transgenic strains. Most notably, the D1 degradation rate is significantly faster in transgenic strains, with D1 signals becoming very weak after 60 minutes of high-light exposure compared to wild-type strains where damaged D1 remains clearly detectable .

What molecular mechanisms regulate the expression of DnaK2 in response to environmental stressors in Nostoc flagelliforme?

The expression of NfDnaK2 is regulated by specific transcription factors that respond to environmental stressors such as drought. Two key transcription factors have been identified: NfRre1 (COO91_05451) and NfPedR (COO91_04806). Both contain an N-terminal receiver domain and a C-terminal DNA-binding domain, belonging to the NarL/FixJ family. Electrophoretic mobility shift assays (EMSA) demonstrate that these transcription factors physically bind to the promoter2-1 region of the NfdnaK2 gene. The transcriptional response pattern of these factors, particularly NfRre1, closely matches that of NfdnaK2 during drought stress, suggesting they act as positive regulators. This regulatory mechanism allows for precise control of chaperone expression under varying environmental conditions, ensuring cellular resources are allocated to stress response only when needed .

How does the interaction between DnaK2 and its co-chaperones affect the stability and function of FtsH proteases in the PSII repair cycle?

The DnaK2 chaperone functions in conjunction with specific J-domain co-chaperones to maintain PSII activity. In Nostoc flagelliforme, NfDnaK2 interacts with NfDnaJ9 to form a functional chaperone pair. This chaperone system appears to facilitate the proper folding and membrane integration of FtsH proteases, particularly NfFtsH2, which is critical for the degradation of damaged D1 proteins during PSII repair. Mass spectrometry analysis shows that transgenic Nostoc sp. PCC 7120 expressing NfDnaK2 exhibits a 65% increase in FtsH2 content in membrane fractions compared to wild-type strains. This suggests that the NfDnaK2-NfDnaJ9 chaperone system enhances PSII repair by promoting the accumulation and activity of FtsH2 proteases in thylakoid membranes, thereby accelerating the degradation of photodamaged D1 proteins .

What techniques are most effective for measuring PSII repair efficiency in recombinant Nostoc strains?

To effectively measure PSII repair efficiency in recombinant Nostoc strains, researchers employ a multi-faceted approach combining biophysical and biochemical techniques:

  • Chlorophyll Fluorescence Analysis: Measuring maximum potential quantum efficiency of PSII (Fv/Fm values) with and without protein synthesis inhibitors (e.g., lincomycin) to differentiate between repair and photoprotection mechanisms.

  • Oxygen Evolution Measurements: Quantifying PSII activity through oxygen production rates under controlled light conditions.

  • Immunoblot Analysis: Tracking the degradation rate of D1 protein under high light stress using specific antibodies.

  • Mass Spectrometry: Determining the relative abundance of key proteins involved in PSII repair (e.g., FtsH2 protease) in membrane fractions.

For optimal results, experiments should compare transgenic and wild-type strains under identical stress conditions (e.g., high light at 400 μmol photons m⁻² s⁻¹) with appropriate controls to account for protein synthesis inhibition .

What are the most reliable protocols for photobleaching experiments to study phycobilisome mobility in Nostoc sp.?

For reliable photobleaching experiments to study phycobilisome mobility in Nostoc species, the following protocol has been validated:

  • Sample Preparation: Cell suspensions should be spotted onto agar-coated glass slides (1.5% Bacto-Agar with growth medium) to immobilize cells while maintaining physiological conditions.

  • Microscopy Setup: Using a confocal microscope (e.g., Zeiss LSM 710 NLO & DuoScan System) with a high-magnification oil immersion objective (Plan-Apochromat 100×/1.40).

  • Photobleaching Parameters:

    • Select a small, consistent area (0.01 μm²) for photobleaching to ensure reproducibility

    • Use a 561 nm argon laser at 100% power for bleaching

    • Vary bleach duration (500-1500 ms) or number of iterations (100-300 repeats) to achieve different degrees of photobleaching

  • Imaging: Excite phycobilisomes with the same 561 nm laser but at reduced power (10%), detecting fluorescence with a 620/670 emission filter.

  • Analysis: Process images and quantify fluorescence recovery using ImageJ v1.8.0 software.

This methodology allows for precise measurement of phycobilisome mobility, which is crucial for understanding energy transfer mechanisms in photosynthetic apparatuses .

What genetic engineering approaches are most suitable for constructing recombinant Nostoc strains with enhanced photosynthetic capabilities?

For constructing recombinant Nostoc strains with enhanced photosynthetic capabilities, two primary genetic engineering approaches have proven effective:

Approach 1: Replicative Plasmid Transformation

  • Utilize replicative plasmids like pRL1049 as vectors

  • Place genes of interest under control of constitutive promoters (e.g., PpsbA from Amaranthus hybridus)

  • Introduce plasmids via triparental mating using helper strains (E. coli J53/RP4) and cargo strains

  • Advantages: Faster screening of positive transformants

  • Limitations: Heterogeneous expression patterns and potential plasmid instability

Approach 2: Genomic Integration via Homologous Recombination

  • Construct integrative plasmids containing:

    • Homologous flanking regions targeting neutral genomic sites (e.g., nucA-nuiA)

    • Genes of interest with appropriate promoters and terminators

    • Selection markers (e.g., aad1 for spectinomycin/streptomycin resistance)

  • Introduce via triparental mating followed by double-crossover selection using sucrose sensitivity (sacB system)

  • Advantages: Stable expression and uniform distribution of the recombinant protein

  • Limitations: Longer screening time (approximately 21 days)

Both approaches should be complemented with appropriate phenotypic verification methods, such as fluorescence microscopy for visualizing protein localization or functional assays for confirming enhanced photosynthetic activity.

How should researchers interpret conflicting data on DnaK2 function across different cyanobacterial species?

When facing conflicting data on DnaK2 function across different cyanobacterial species, researchers should consider the following analytical framework:

When interpreting conflicting results, prioritize data from heterologous expression studies (like NfDnaK2 in Nostoc sp. PCC 7120) that directly compare wild-type and transgenic strains under identical conditions, as these provide the most reliable evidence for specific functional roles .

What quantitative metrics best represent the efficiency of PSII repair in recombinant Nostoc strains?

The efficiency of PSII repair in recombinant Nostoc strains can be most effectively quantified using the following metrics:

MetricMeasurement MethodSignificanceTypical Values in Enhanced Strains
Fv/Fm Recovery RateChlorophyll fluorescence with/without lincomycinDirectly measures PSII quantum efficiency recovery15-30% higher than wild-type
D1 Protein Turnover RateImmunoblot analysis during high light exposureIndicates efficiency of damaged D1 removal60-70% faster degradation than wild-type
FtsH2 Protease AbundanceMass spectrometry of membrane fractionsMeasures key repair machinery component65% increase compared to wild-type
O₂ Evolution RateClark-type electrode measurementsFunctional outcome of PSII repair20-40% higher under stress conditions
Thylakoid Membrane IntegrityElectron microscopy and spectroscopic analysisStructural foundation for repair processesMaintained structure under stress conditions

When analyzing these metrics, it's crucial to calculate the repair-specific component by comparing measurements with and without protein synthesis inhibitors. The difference between PSII activity in the absence and presence of lincomycin represents the specific contribution of the repair mechanisms. Additionally, time-course analyses provide more valuable information than single time-point measurements, as they capture the dynamic nature of the repair process .

How can researchers effectively distinguish between direct and indirect effects of recombinant proteins on photosynthetic efficiency?

To effectively distinguish between direct and indirect effects of recombinant proteins on photosynthetic efficiency, researchers should implement a systematic experimental design:

  • Protein Interaction Verification:

    • Employ co-immunoprecipitation or pull-down assays to identify direct binding partners

    • Use yeast two-hybrid or split-GFP systems to confirm specific protein-protein interactions

    • Verify interaction sites through site-directed mutagenesis of key residues

  • Temporal Analysis:

    • Monitor changes in photosynthetic parameters and protein abundance at short intervals after induction

    • Direct effects typically manifest more rapidly than indirect effects

    • Establish clear temporal relationships between protein activity and observed phenotypes

  • Genetic Complementation:

    • Express individual domains of the recombinant protein to identify functional regions

    • Create chimeric proteins with domains from different species to determine specificity

    • Use domain-specific mutations that affect particular functions while preserving others

  • Subcellular Localization Studies:

    • Determine precise localization of recombinant proteins using fluorescent tags or immunogold labeling

    • Co-localization with known PSII components suggests direct effects

    • Changes in proteins distant from the recombinant protein's location indicate indirect effects

  • Comparative Proteomics:

    • Analyze changes in the entire proteome following recombinant protein expression

    • Categorize affected proteins by function and location

    • Map protein networks to identify direct interaction pathways versus downstream effects

What are the most promising targets for genetic engineering to enhance PSII repair in Nostoc species under extreme environmental conditions?

Based on current research, the most promising targets for genetic engineering to enhance PSII repair in Nostoc species under extreme conditions include:

  • Chaperone Systems: Building on the success with NfDnaK2, engineering optimized chaperone-cochaperone pairs could further enhance PSII repair. Specifically, co-expressing NfDnaK2 with its partner NfDnaJ9 in precise stoichiometric ratios could maximize their synergistic effects on FtsH2 protease stability and function.

  • FtsH Proteases: Direct overexpression or engineering of FtsH2 proteases with enhanced stability under extreme conditions could accelerate damaged D1 protein removal. Targeted modifications to the transmembrane domains may improve thylakoid membrane integration under stress conditions.

  • Transcriptional Regulators: Engineering the transcription factors NfRre1 and NfPedR to respond more sensitively to environmental stress signals could ensure earlier activation of repair mechanisms. Creating synthetic promoters with optimized binding sites for these factors could enhance expression of repair proteins.

  • D1 Protein Variants: Introducing naturally stress-tolerant D1 protein variants from extremophilic cyanobacteria or engineering D1 proteins with reduced susceptibility to photodamage could decrease repair requirements under extreme conditions.

  • Energy Allocation Systems: Engineering proteins involved in regulating energy distribution between photosystems could help protect PSII under stress by modulating excitation pressure.

How might advanced imaging techniques be applied to better understand the dynamics of PSII repair in living Nostoc filaments?

Advanced imaging techniques offer unprecedented opportunities to understand PSII repair dynamics in living Nostoc filaments:

  • Super-Resolution Microscopy:

    • Techniques like PALM, STORM, or STED microscopy could visualize the nanoscale organization of PSII repair complexes

    • Track individual repair proteins with 20-30 nm resolution to map repair microdomains within thylakoid membranes

    • Observe chaperone-substrate interactions in real-time during repair processes

  • Fluorescence Lifetime Imaging Microscopy (FLIM):

    • Monitor changes in protein-protein interactions through FRET-FLIM

    • Detect conformational changes in repair proteins during active cycles

    • Measure energy transfer efficiency changes during repair in living cells

  • Label-Free Imaging:

    • Raman microscopy to detect chemical signatures of repair events

    • Second harmonic generation imaging to visualize membrane reorganization during repair

    • Quantitative phase imaging to measure mass transport during protein turnover

  • 4D Imaging (3D + Time):

    • Follow repair processes throughout filaments over time

    • Analyze cell-to-cell variability and communication during stress response

    • Correlate repair dynamics with filament development and differentiation

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence tracking of repair proteins with ultrastructural analysis

    • Map repair events to specific thylakoid membrane regions

    • Analyze membrane remodeling during repair at nanometer resolution

These techniques would be particularly valuable when applied to photobleaching experiments similar to those described for phycobilisome mobility studies, but adapted to track PSII repair components like NfDnaK2, NfDnaJ9, and FtsH2 protease .

What computational approaches could help predict the functional impact of mutations in photosystem proteins in Nostoc species?

Several computational approaches could significantly enhance our ability to predict the functional impact of mutations in photosystem proteins in Nostoc species:

  • Molecular Dynamics Simulations:

    • Simulate protein dynamics under different environmental conditions (temperature, pH, ionic strength)

    • Predict how mutations affect protein stability, flexibility, and interactions

    • Model water and ion movements within photosystem complexes to understand energy transfer mechanisms

  • Machine Learning Algorithms:

    • Develop neural networks trained on existing mutation data to predict functional outcomes

    • Implement deep learning approaches for analyzing sequence-structure-function relationships

    • Create classification systems for mutation effects based on conservation patterns across cyanobacterial species

  • Systems Biology Modeling:

    • Construct comprehensive models of PSII repair pathways including all known components

    • Simulate flux through repair pathways under varying stress conditions

    • Predict system-wide effects of mutations in specific components

  • Evolutionary Coupling Analysis:

    • Identify co-evolving residues that maintain functional interactions between proteins

    • Predict compensatory mutations that could restore function after deleterious changes

    • Map functionally important interaction networks across the photosynthetic apparatus

  • Quantum Mechanics/Molecular Mechanics (QM/MM) Approaches:

    • Model electron transfer processes in photosystem reaction centers

    • Predict how mutations affect the energetics of charge separation and stabilization

    • Simulate excitation energy transfer through light-harvesting antenna systems

These computational approaches would be particularly valuable for designing enhanced versions of proteins like NfDnaK2 and FtsH2 proteases with improved functionality under extreme environmental conditions, potentially leading to more efficient photosynthetic repair systems in engineered Nostoc strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.