Recombinant Nostoc sp. Photosystem Q (B) protein 3 (psbA5)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

psbA5 encodes a high-light-inducible D1 protein isoform with a glutamate residue at position 130 (Glu130), replacing glutamine (Gln130) in standard D1 proteins. This substitution enhances PSII repair under oxidative stress and desiccation by:

  • Reducing Photoinhibition: Glu130 stabilizes charge separation under high-light conditions, minimizing photodamage .

  • Desiccation Tolerance: In Nostoc flagelliforme, psbA5 transcription increases 3.8-fold during dehydration, enabling rapid D1 turnover and PSII reassembly .

  • Regulatory Interaction: Coordinated expression with high light-inducible proteins (Hlips) via the transcription factor Hrf1 ensures synchronized stress responses .

Proteomic and Transcriptomic Insights

  • Diazotrophic Stress: Under nitrogen starvation, psbA5 expression is indirectly suppressed by the cyanotoxin β-N-methylamino-L-alanine (BMAA), which downregulates photosynthetic and nitrogen-metabolism proteins .

  • Oxidative Stress: PsbA5-containing PSII complexes show resilience to reactive oxygen species (ROS), as observed in Nostoc sp. PCC 7120 under diazotrophic conditions .

Comparative Expression of psbA Paralogs

GeneD1 VariantExpression (Dehydration)Function
psbA3Gln130DownregulatedBaseline PSII activity
psbA5Glu1303.8-fold increaseHigh-light/desiccation adaptation

Biotechnological Applications

  • Protein Engineering: Recombinant psbA5 serves as a template for studying PSII evolution and designing stress-tolerant photosynthetic systems .

  • Industrial Production: Large-scale E. coli-based expression (e.g., 50 µg batches) supports biochemical assays and antibody development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our standard shipping procedure involves using normal blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA5; psbA-5; alr3742; Photosystem II protein D1 3; PSII D1 protein 3; Photosystem II Q(B protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
psbA5
Target Protein Sequence
MTTLLEQRSSANLWHRFGNWITSTENRMYVGWFGVLLIPTALTAAIVFILAFIAAPPVDV DGIREPVSGSLLYGNNIITATVVPTSAAIGLHLYPIWEAASLDEWLYNGGPYQMIVLHFL IAIYAYMGRQWELSYRLGMRPWIPVAFSAPVAAATAVLLIYPIGQGSFSDGMMLGISGTF NFMIVFSPEHNILMHPFHMIGVAGVFGGALFSAMHGSLVTSTLVRETSEVESANTGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFAALGISTMSFNLNGF NFNNSILDHQGRTIDTWADLLNRANLGIEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient that is subsequently utilized for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: ana:alr3742

STRING: 103690.alr3742

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is psbA5 and what role does it play in Nostoc species?

PsbA5 is a specialized D1 protein encoded by the psbA5 gene in Nostoc species. It is a desiccation-induced variant that contains a Glu-130 residue, distinguishing it from constitutively expressed D1 proteins. In Nostoc flagelliforme and related desert cyanobacteria, psbA5 plays a crucial role in photosystem II (PSII) repair and photoprotection during dehydration and rehydration cycles. The protein facilitates rapid turnover of damaged D1 proteins, allowing for efficient PSII repair and resumption of photosynthetic activity upon rehydration .

Why is recombinant psbA5 important for studying desiccation tolerance?

Recombinant psbA5 provides researchers with a purified protein system to study the molecular mechanisms of desiccation tolerance in photosynthetic organisms. By working with the recombinant protein, researchers can conduct detailed structural and functional analyses that would be difficult using whole-cell systems. Studies have shown that desiccation-induced psbA variants like psbA5 are essential for the rapid turnover of D1 during PSII repair in desert cyanobacteria, which is a key factor in their resistance to high illumination and desiccation stress . Recombinant protein studies allow for precise manipulations to determine structure-function relationships and interaction partners.

What expression systems are most effective for recombinant psbA5 production?

For recombinant psbA5 production, heterologous expression in cyanobacterial hosts has shown promising results. Based on methodologies described for similar proteins, the optimal approach involves:

  • Cloning the psbA5 gene into a shuttle vector (such as pRL25C) under the control of a strong promoter (like Nfrbcl promoter)

  • Including an efficient ribosome binding site fused to the 5′ end of the upstream primer

  • Transformation into a suitable host (such as Nostoc sp. PCC 7120) via conjugal transfer

  • Selection of transformants on appropriate media (e.g., 1% agar BG11 plates with 30 μg mL−1 spectinomycin)

  • Confirmation of positive clones by PCR and sequencing

This methodology has been successfully employed for the heterologous expression of related proteins in Nostoc sp. PCC 7120, resulting in enhanced desiccation tolerance in the transgenic strain.

What are the challenges in purifying functional recombinant psbA5?

Purifying functional recombinant psbA5 presents several challenges:

ChallengePotential SolutionResearch Consideration
Membrane protein isolationDetergent optimization (e.g., β-DDM, OG)Different detergents may affect protein stability and activity
Maintaining protein foldingAddition of glycerol (10-15%) to buffersMonitor protein secondary structure via circular dichroism
Cofactor associationReconstitution with chlorophyll and other cofactorsVerify cofactor binding through absorption spectroscopy
Preventing proteolysisAddition of protease inhibitorsConfirm protein integrity by SDS-PAGE and Western blotting
Aggregation preventionOptimization of pH and ionic strengthAssess homogeneity by size-exclusion chromatography

The extracellular accumulation of photosystem components observed under stress conditions suggests that special attention should be paid to protein localization and solubility issues during purification .

How can the functional activity of recombinant psbA5 be assessed?

Functional assessment of recombinant psbA5 can be performed through multiple complementary techniques:

  • Chlorophyll fluorescence measurements: Monitor PSII efficiency (Fv/Fm) in reconstituted systems or in vivo in transgenic strains expressing recombinant psbA5, particularly under desiccation stress conditions

  • Oxygen evolution assays: Measure oxygen production rates using Clark-type electrodes

  • Immunofluorescence microscopy (IFM): Track the localization and turnover of psbA5 during dehydration-rehydration cycles

  • Binding assays: Examine interactions with other PSII components and regulatory proteins

  • Electron transport rates: Assess the electron flow through PSII using artificial electron acceptors

These methods collectively provide insights into how psbA5 contributes to photosystem stability and repair under desiccation stress .

What experimental approaches can be used to study psbA5's role in PSII repair?

To investigate psbA5's specific role in PSII repair mechanisms:

  • Pulse-chase experiments with isotope-labeled amino acids to track D1 turnover rates

  • Site-directed mutagenesis of key residues (particularly Glu-130) to determine their functional significance

  • Time-resolved studies of PSII recovery after photoinhibition in systems with and without functional psbA5

  • Comparative analysis between wild-type strains and those with deleted or modified psbA5

  • Cross-linking studies to identify protein-protein interactions during the repair cycle

Research has shown that desiccation tolerance in Nostoc flagelliforme depends significantly on impaired photosystem II repair mechanisms, suggesting psbA5's critical role in this process .

How does psbA5 contribute to the desiccation tolerance mechanism in desert cyanobacteria?

PsbA5 contributes to desiccation tolerance through multiple mechanisms:

  • Enhanced D1 turnover: The rapid replacement of damaged D1 proteins is crucial during dehydration and rehydration cycles

  • Specialized structural features: The Glu-130 containing D1 variant may confer specific adaptations to water deficiency

  • Photoprotection: PsbA5 appears to work in concert with high light-inducible proteins (Hlips) to minimize photodamage during dehydration

  • Cyclic electron flow: PsbA5 may facilitate alternative electron transport pathways that protect PSII under desiccation stress

  • Coordinated regulation: The synchronized expression of psbA5 and hlips-cluster, regulated by Hrf1, enables rapid response to changing water conditions

These mechanisms collectively allow desert cyanobacteria like Nostoc flagelliforme to rapidly resume photosynthetic activity during the brief periods when both hydration and light are available .

What is the relationship between psbA5 and high light-inducible proteins (Hlips) in desiccation response?

The relationship between psbA5 and Hlips represents a sophisticated evolutionary adaptation:

  • Co-regulation: Both psbA5 and the hlips-cluster are regulated by the transcription factor Hrf1, ensuring coordinated expression during dehydration stress

  • Functional synergy: While psbA5 facilitates D1 turnover in PSII repair, Hlips bind chlorophyll and provide photoprotection by dissipating excess excitation energy

  • Coevolutionary history: Phylogenetic analysis reveals that most species possessing both tandemly repeated Hlips and Hrf1 (the regulator of psbA5) belong to the genus Nostoc, with approximately 88.5% probability of these elements coexisting in the same genome

  • Habitat adaptation: Among strains containing both Hlips-cluster and Hrf1 (and by extension, regulated psbA5), approximately 82% can adapt to terrestrial habitats such as desert or woodland

  • Complementary protective mechanisms: While psbA5 focuses on PSII repair, Hlips prevent photodamage, together minimizing the damaging effects of desiccation and high light

How can recombinant psbA5 be utilized in synthetic biology applications for drought tolerance?

Recombinant psbA5 offers several promising applications in synthetic biology for enhancing drought tolerance:

  • Transgenic expression in model organisms: The heterologous expression of psbA5 from Nostoc flagelliforme in Nostoc sp. PCC 7120 has already demonstrated enhanced desiccation tolerance, suggesting potential for broader applications

  • Engineering minimal photosystems: Designing simplified PSII complexes incorporating psbA5 for improved stress resistance

  • Creating chimeric proteins: Developing fusion proteins combining functional domains of psbA5 with other stress-responsive elements

  • Pathway engineering: Integrating psbA5 with the hlips-cluster and their regulatory elements to recreate complete desiccation tolerance mechanisms

  • Stress-responsive genetic circuits: Developing synthetic gene networks that trigger psbA5 expression in response to early indicators of drought stress

Experiments have shown that transgenic strains expressing the hlips-cluster (which works in concert with psbA5) demonstrated improved photosystem stability under water-deficit conditions, as measured by chlorophyll fluorescence (Fv/Fm) and growth under PEG 6000-simulated drought stress .

What methodological approaches can resolve contradictory findings about psbA5 localization under stress conditions?

To resolve contradictions regarding psbA5 localization under stress:

  • Combined proteomic and microscopy techniques:

    • Shotgun proteomics of cellular fractions under different stress conditions

    • Immunofluorescence microscopy with antibodies specific to psbA5

    • Correlative light and electron microscopy to precisely locate psbA5 at the ultrastructural level

  • Time-resolved studies:

    • Tracking psbA5 localization at multiple timepoints during dehydration-rehydration cycles

    • Pulse-chase experiments to distinguish newly synthesized from recycled proteins

  • Conditional expression systems:

    • Creating reporter fusions that allow real-time visualization of psbA5 localization

    • Inducible expression systems to control timing and level of psbA5 production

  • Comparative analysis across conditions:

    • Parallel examination under nitrogen-deplete (BG11₀) and nitrogen-replete (BG11) conditions

    • Evaluation under different carbon availability scenarios

Research has shown that the extracellular accumulation of photosystem components varies significantly between nitrogen-deplete and nitrogen-replete conditions, suggesting that nutrient status strongly influences protein localization patterns . Similar methodologies could be applied to resolve contradictory findings about psbA5 localization.

How can computational modeling improve understanding of psbA5 function in photosystem dynamics?

Computational modeling approaches provide powerful tools for understanding psbA5 function:

  • Molecular dynamics simulations:

    • Modeling the structural dynamics of psbA5 within the PSII complex

    • Simulating water-loss effects on protein conformation and stability

    • Predicting the impact of the Glu-130 residue on protein-protein interactions

  • Systems biology approaches:

    • Network modeling of gene regulatory circuits involving Hrf1, psbA5, and hlips

    • Flux balance analysis to predict metabolic adaptations during desiccation

    • Agent-based modeling of PSII repair cycle dynamics

  • Evolutionary sequence analysis:

    • Comparative genomics to identify conserved functional domains

    • Positive selection analysis to detect adaptation signatures

    • Ancestral sequence reconstruction to understand the evolutionary trajectory of psbA5

  • Machine learning applications:

    • Pattern recognition in expression data across environmental conditions

    • Prediction of protein-protein interaction networks

    • Feature extraction from experimental datasets to identify key functional determinants

These computational approaches can generate testable hypotheses about the mechanistic role of psbA5 in desiccation tolerance and guide experimental design for further studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.