Recombinant Nostoc sp. Potassium-transporting ATPase C chain 1 (kdpC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
kdpC1; all3151; Potassium-transporting ATPase KdpC subunit 1; ATP phosphohydrolase [potassium-transporting] C chain 1; Potassium-binding and translocating subunit C 1; Potassium-translocating ATPase C chain 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
kdpC1
Target Protein Sequence
MSFAREASRAIRSSFVLWVIAAVIYPFFMIAVGQIVFPHQANGSLVRDSRGQVLGSTLIG QPFTSDRYFNSRPSTTVYSTANPNKDDNLVLQTGISGASNLAPSNPQLIERIKDEDLNRL QTSGIQPTADLVYTSGSSLDPHITPEAARAQVSRIAKVRQLPPQQLETLITQNTDSRFLG IFGEPGVNVLQLNLALDELKPT
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Database Links

KEGG: ana:all3151

STRING: 103690.all3151

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Nostoc sp. Potassium-transporting ATPase C chain 1 (kdpC1) and its role in cyanobacterial physiology?

The kdpC1 is a component of the high-affinity potassium uptake system (Kdp-ATPase complex) in the cyanobacterium Nostoc sp. This protein is encoded by the kdp1 operon and plays a crucial role in the assembly of the Kdp-ATPase complex. In cyanobacteria like Nostoc, the Kdp-ATPase functions as an efficient potassium scavenging enzyme that is produced when cellular potassium requirements cannot be met by other K+ uptake proteins, especially when extracellular K+ concentrations fall below 50 μM .

Unlike other P-type ATPases where the central phosphorylated subunit also transports ions, in the Kdp-ATPase complex, ATP hydrolysis is carried out by KdpB while KdpA is responsible for potassium transport. The KdpC subunit is essential for the assembly and stabilization of the entire complex, making it indispensable for Kdp-ATPase activity .

How is the kdp1 operon organized in Nostoc sp., and how does it differ from the kdp2 operon?

The organization of kdp operons in Nostoc (Anabaena) reveals interesting structural differences:

Featurekdp1 Operonkdp2 Operon
Gene componentskdpA1, kdpB1, kdpG1, kdpC1, kdpDkdpA2, kdpB2, kdpG2, kdpC2
Total ORFs54
Unique featuresContains a truncated kdpD ORF downstream of kdpC1No kdpD ORF present
Additional componentskdpG1 present between kdpB1 and kdpC1kdpG2 present between kdpB2 and kdpC2
Response to K+ limitationNot inducedStrongly induced (5.3-kb transcript)
Response to desiccationNot reportedStrongly induced

A notable difference is that the kdp1 operon contains a truncated kdpD gene (365 amino acids) that shows similarity only to the N-terminal domain of E. coli KdpD, lacking the critical C-terminal histidine kinase domain responsible for phosphorylation reactions .

What conditions regulate the expression of kdpC1 in Nostoc sp.?

While the kdp2 operon in Nostoc is strongly regulated by potassium limitation and desiccation stress, the kdp1 operon (containing kdpC1) shows different regulation patterns:

  • Potassium limitation: Unlike kdp2, the kdp1 operon is not induced under potassium limitation (<50 μM K+ in medium) .

  • Salt stress: Addition of common salt does not induce kdp1 expression in Anabaena L-31, unlike in E. coli and Salmonella typhimurium .

  • pH variations: Changes in medium pH do not affect kdp1 expression .

  • Heat stress: Does not induce kdp1 expression .

  • Nitrogen status: The presence or absence of combined nitrogen in the growth medium does not affect kdp1 expression .

This differential regulation suggests that the two kdp operons in Nostoc have evolved for distinct physiological roles, with kdp1 potentially serving functions beyond simple potassium uptake during limitation.

How can researchers methodically study the transcriptional regulation of kdpC1?

To study transcriptional regulation of kdpC1, researchers should employ a multi-faceted approach:

  • Northern blot analysis: To detect and quantify kdpC1 mRNA under different conditions. This technique successfully identified the 5.3-kb transcript of the kdp2 operon in K+-starved cells, though similar analysis of kdp1 would require appropriate conditions for its induction .

  • Quantitative RT-PCR: For more sensitive detection of transcriptional changes. This approach could reveal subtle expression changes in kdp1 that might be missed by Northern blotting.

  • Promoter-reporter fusion constructs: By fusing the promoter region of kdpC1 to reporter genes (such as gfp or lacZ), researchers can monitor promoter activity under various conditions in vivo.

  • Chromatin immunoprecipitation (ChIP): To identify transcription factors that bind to the kdpC1 promoter region.

  • Proteomic analysis: Similar to the approach used for studying Nostoc under nitrogen starvation conditions, mass spectrometry-based proteomics can identify changes in KdpC1 protein levels in response to various stimuli .

What methods are effective for expressing and purifying recombinant KdpC1 for structural studies?

Expressing and purifying recombinant KdpC1 requires careful methodological consideration:

  • Expression system selection: Based on commercial recombinant proteins, E. coli, yeast, baculovirus, or mammalian cell systems can be used for expression . E. coli systems are commonly used for initial studies due to their simplicity and high yield potential.

  • Optimization protocol:

    • Clone the kdpC1 gene into an appropriate expression vector with a purification tag (His, GST, or MBP)

    • Transform into E. coli expression strains (BL21(DE3), Rosetta, or Arctic Express)

    • Optimize expression conditions (temperature, IPTG concentration, induction time)

    • For membrane-associated proteins like KdpC1, lower expression temperatures (16-20°C) often improve proper folding

  • Purification strategy:

    • Lysis in buffer containing appropriate detergents (e.g., DDM, LDAO) for membrane proteins

    • Affinity chromatography using the fusion tag

    • Size exclusion chromatography for final purification

    • Maintain >90% purity as achieved with commercial recombinant proteins

  • Storage considerations: Store purified protein at -20°C or -80°C for long-term storage, with working aliquots at 4°C for up to one week. Avoid repeated freeze-thaw cycles .

How does KdpC1 interact with other components of the Kdp-ATPase complex?

Understanding the protein-protein interactions of KdpC1 requires specialized methodological approaches:

  • Co-immunoprecipitation (Co-IP): To identify physical associations between KdpC1 and other Kdp complex components in vivo.

  • Surface Plasmon Resonance (SPR): To determine binding kinetics and affinity constants between purified KdpC1 and other subunits.

  • Cross-linking studies followed by mass spectrometry: To identify interaction interfaces between KdpC1 and its binding partners.

  • Yeast two-hybrid or bacterial two-hybrid assays: For initial screening of protein-protein interactions.

From the available research, we know that in the Kdp-ATPase complex, KdpC is essential for the assembly of the whole complex . The complex architecture likely involves interactions between KdpC1 and both KdpA1 (the potassium transport subunit) and KdpB1 (the ATP hydrolysis subunit). The presence of the unique KdpG1 protein between KdpB1 and KdpC1 in Nostoc suggests additional interaction complexity not found in E. coli .

How can CRISPR-Cas9 technology be utilized to study kdpC1 function in Nostoc sp.?

CRISPR-Cas9 technology offers powerful approaches for studying kdpC1 function in Nostoc:

  • Gene knockout strategy:

    • Design sgRNAs targeting the kdpC1 gene

    • Use a CRISPR-Cas9 system optimized for cyanobacteria (similar to the CRISPR-interference approach used for Alr4641 in Anabaena PCC 7120)

    • Screen transformants for complete knockout or knockdown

    • Verify knockouts using PCR, Western blotting, and sequencing

  • Knockdown approach using dCas9 (CRISPRi):

    • Use catalytically inactive Cas9 (dCas9) fused to a repressor domain

    • Target the kdpC1 promoter or coding region

    • This approach was successfully used for the knockdown of alr4641 in Anabaena PCC 7120, resulting in ~85% reduction in protein levels

  • Phenotypic analysis of mutants:

    • Growth characteristics under varying potassium concentrations

    • Potassium uptake assays

    • Transcriptomic and proteomic profiling to identify affected pathways

    • Stress response testing (particularly under desiccation conditions)

  • Complementation studies:

    • Reintroduce wild-type or mutated versions of kdpC1 to assess function

What are the methodological considerations for studying the role of KdpC1 in stress response mechanisms?

To comprehensively investigate KdpC1's role in stress responses:

  • Multi-stress experimental design:

    • Subject Nostoc cultures to various stressors: potassium limitation, desiccation, osmotic stress, oxidative stress

    • Monitor kdpC1 expression using qRT-PCR and/or Western blotting

    • Compare responses between wild-type and kdpC1 mutant strains

  • Physiological measurements:

    • Potassium content determination using atomic absorption spectroscopy

    • Membrane potential measurements

    • Growth rate and viability assessments under stress conditions

  • Global response analysis:

    • Transcriptomic profiling (RNA-Seq) to identify genes co-regulated with kdpC1

    • Proteomic analysis to detect changes in protein abundance and modifications

    • Metabolomic analysis to identify metabolic changes associated with KdpC1 function

  • Comparative analysis with kdp2 operon:

    • Since kdp2 is induced by desiccation stress while kdp1 is not , comparative studies can reveal unique aspects of each system's function

How conserved is KdpC1 across different cyanobacterial species?

Phylogenetic analysis of nitrate-ABC-transporter proteins in cyanobacteria (as a model for other transporter systems) has shown that these proteins are highly conserved among cyanobacterial species, though sequence variations exist, resulting in several subclades . Similarly, the Kdp-ATPase system likely shows conservation patterns with species-specific variations.

For Nostoc/Anabaena specifically:

  • Nostoc PCC 7120 is very close to Anabaena variabilis ATCC 29413, Anabaena sp. 4-3, and Anabaena sp. CA = ATCC 33047

  • Nostoc spp. NIES-3756 and PCC 7524 are often found in the same subclade

These phylogenetic relationships can provide insight into the evolutionary conservation of KdpC1 and its functional importance across different cyanobacterial species.

What can comparative genomics reveal about the unique features of Nostoc kdp operons?

Comparative genomics analysis would reveal:

  • Operon structure variation: The presence of additional genes (like kdpG) between kdpB and kdpC in both kdp1 and kdp2 operons of Nostoc represents a unique feature not found in well-studied bacteria like E. coli .

  • Regulatory element divergence: The truncated kdpD in the kdp1 operon lacking the histidine kinase domain, and the absence of kdpE-like genes downstream of both kdp operons, suggests a fundamentally different regulatory mechanism compared to E. coli .

  • Duplication and specialization: The presence of two distinct kdp operons in Nostoc, with differential regulation (kdp2 responding to K+ limitation and desiccation, while kdp1 does not), suggests gene duplication followed by functional specialization .

  • Evolutionary adaptation: The unique response patterns (such as desiccation induction of kdp2) likely reflect evolutionary adaptations to the ecological niches occupied by cyanobacteria compared to enteric bacteria.

What are the common challenges in working with recombinant KdpC1 and how can they be addressed?

Working with recombinant KdpC1 presents several technical challenges:

  • Protein solubility issues:

    • Challenge: As part of a membrane-associated complex, KdpC1 may have solubility issues

    • Solution: Use fusion tags that enhance solubility (MBP, SUMO); optimize detergent conditions; consider expressing truncated functional domains

  • Maintaining protein stability:

    • Challenge: Purified KdpC1 may lose activity during storage

    • Solution: Store in buffer containing glycerol (50%) at -20°C or -80°C; avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

  • Functional assay development:

    • Challenge: Assessing functionality of KdpC1 outside the complete Kdp complex

    • Solution: Co-express with other components of the complex; develop binding assays to measure interactions with KdpA1 and KdpB1

  • Protein-protein interaction verification:

    • Challenge: Confirming physiologically relevant interactions

    • Solution: Use multiple complementary techniques (Co-IP, SPR, crosslinking); validate in vivo using FRET or split-GFP approaches

What experimental controls are critical when studying kdpC1 expression and function?

When studying kdpC1, the following controls are essential:

  • For expression studies:

    • Positive control: Include conditions known to induce kdp2 expression (K+ limitation, desiccation)

    • Negative control: Standard growth conditions with sufficient K+

    • Housekeeping gene controls: Use multiple reference genes for normalization in qRT-PCR

    • Time-course analysis: Monitor expression at multiple time points to capture dynamic changes

  • For protein function studies:

    • Complementation controls: Verify that phenotypes of kdpC1 mutants can be rescued by expression of wild-type kdpC1

    • Domain-specific mutations: Create point mutations in functional domains to confirm structure-function relationships

    • Cross-complementation: Test whether kdpC2 can functionally replace kdpC1 and vice versa

  • For interaction studies:

    • Non-specific binding controls: Include unrelated proteins of similar size/charge

    • Competition assays: Use unlabeled proteins to demonstrate binding specificity

    • Negative controls: Test interactions with mutated versions of interaction partners

How might understanding KdpC1 function contribute to biotechnological applications?

Understanding KdpC1 function has several potential biotechnological applications:

  • Engineered stress tolerance: Knowledge of how KdpC1 contributes to potassium homeostasis could be applied to engineer cyanobacteria with enhanced tolerance to potassium limitation and other stresses for biotechnology applications.

  • Biosensor development: The kdp system could be engineered as a biosensor for potassium levels or specific stress conditions, similar to other bacterial sensory systems.

  • Protein engineering platforms: The unique structural features of the Nostoc Kdp complex (including the additional KdpG subunit) could provide novel scaffolds for protein engineering applications.

  • Agricultural applications: Insights from cyanobacterial potassium homeostasis could inform strategies for improving crop responses to low-potassium soils or drought conditions.

  • Bioremediation tools: The Kdp system's role in ion transport could be leveraged for developing cyanobacterial systems for environmental remediation of contaminated water.

What are the key unanswered questions regarding KdpC1 that warrant further investigation?

Despite current knowledge, several critical questions about KdpC1 remain unanswered:

  • Physiological role of kdp1 operon: Since kdp1 is not induced by potassium limitation (unlike kdp2), what is its primary physiological function in Nostoc?

  • Regulatory mechanisms: In the absence of a complete KdpD/KdpE two-component system, how is kdp1 expression regulated? Are there novel regulatory proteins or mechanisms involved?

  • Structural uniqueness: How does the presence of KdpG1 between KdpB1 and KdpC1 affect the structure and function of the Kdp1 complex compared to the E. coli Kdp complex?

  • Heterocyst-specific functions: Is KdpC1 differentially expressed or functionally distinct in heterocysts compared to vegetative cells, given the unique metabolic requirements of nitrogen-fixing cells?

  • Cross-talk with other stress responses: How does the Kdp1 system interact with other stress response mechanisms, such as those involved in oxidative stress protection or desiccation tolerance?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.