Recombinant Nostoc sp. Potassium-transporting ATPase C chain 2 (kdpC2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nostoc sp. Potassium-transporting ATPase C chain 2 (kdpC2)

Recombinant Nostoc sp. Potassium-transporting ATPase C chain 2 (kdpC2) refers to a genetically engineered form of the KdpC subunit derived from Nostoc species, which is a genus of cyanobacteria known for its ability to fix nitrogen and form filamentous colonies . The KdpC subunit is part of the Kdp system, a high-affinity potassium uptake system found in bacteria and archaea . This system is crucial for maintaining potassium homeostasis, which is essential for various cellular processes, including enzyme activity, protein synthesis, and regulation of cell volume .

Structure and Function of Kdp System

The Kdp system is an ATP-dependent potassium transporter composed of three main subunits: KdpA, KdpB, and KdpC .

  • KdpA: This subunit is the potassium-selective pore through which potassium ions are transported across the cell membrane.

  • KdpB: This subunit is an ATPase that provides the energy for potassium transport by hydrolyzing ATP.

  • KdpC: This subunit is a small, membrane-associated protein that modulates the activity of the KdpAB complex.

The KdpC subunit is essential for the proper function and regulation of the Kdp system . It interacts with the KdpAB complex, influencing its activity and potassium affinity. The precise mechanism by which KdpC modulates KdpAB activity is still under investigation, but it is believed to involve conformational changes within the complex .

Genetic and Evolutionary Aspects

The genes encoding the Kdp system are highly conserved in bacteria and archaea, indicating their importance for survival. Phylogenetic analyses suggest that the Kdp system has evolved through horizontal gene transfer, allowing different species to acquire this essential potassium uptake system. Studies involving ancestral gene reconstruction have shown how mutations in proteins can fine-tune their functions . Key mutations can eliminate certain responses, leading to highly specific receptors, and stabilizing permissive mutations are essential for the function-switching mutations to be tolerated .

Role of Nostoc in Nitrogen Fixation and Heterocyst Formation

Nostoc species are unique because they can differentiate specialized cells called heterocysts, which are responsible for nitrogen fixation under anaerobic conditions . Heterocysts develop in response to nitrogen deprivation and are critical for the survival of Nostoc in nitrogen-limited environments . The differentiation and function of heterocysts are tightly regulated, involving various metabolic pathways and regulatory proteins .

Proteomic Studies of Nostoc

Proteomic studies have provided valuable insights into the molecular mechanisms underlying various processes in Nostoc, including the response to environmental stress and the regulation of nitrogen and carbon metabolism . For example, studies have examined the effects of β-methylamino-L-alanine (BMAA) on Nostoc under nitrogen starvation conditions, revealing that BMAA disrupts proteins involved in nitrogen and carbon metabolic pathways .

Nostocyclopeptides and Their Biological Activities

Nostoc species also produce a variety of bioactive secondary metabolites, including nostocyclopeptides (Ncps) . These nonribosomal peptides have been shown to inhibit organic anion transporters and prevent the transport of toxic microcystins and nodularin into hepatocytes . Genetic analysis of Nostoc sp. has revealed the presence of Ncp gene clusters responsible for the synthesis of these peptides .

Biotechnological Potential of Nostoc

Nostoc has several biotechnological applications, including its use as a biofertilizer, a source of bioactive compounds, and a potential platform for bioremediation . Its ability to fix nitrogen, produce exopolysaccharides, and synthesize valuable secondary metabolites makes it a promising candidate for sustainable agriculture and environmental applications .

Growth and Cultivation of Nostoc

The cultivation of Nostoc under controlled laboratory conditions is essential for research and biotechnological applications . Factors such as light intensity, nutrient availability, and medium composition can significantly affect the growth rate and biomass yield of Nostoc . Studies have shown that supplementation with nitrogen can increase the growth rate of Nostoc, while other supplements, such as magnesium, may have inhibitory effects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order for prioritized development.
Synonyms
kdpC2; all4243; Potassium-transporting ATPase KdpC subunit 2; ATP phosphohydrolase [potassium-transporting] C chain 2; Potassium-binding and translocating subunit C 2; Potassium-translocating ATPase C chain 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
kdpC2
Target Protein Sequence
MSFIREILRAIRITLIFWLVTAIIYPLAILVVGQGLFPIQANGSIMENIEGTPIGSTLIS QVFTSEKYFHSRPSAVRYSQGRKAKPTGISGGSNLAPSNPALLERIIEEANQLRDENVQP IADLIYSSGSGLDPHISVQAARQQLERVARARGVQPDEILLAINKFTDGRFLGIFGEPGV NVLRLNYALDLQDINRQQN
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links

KEGG: ana:all4243

STRING: 103690.all4243

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Recombinant Nostoc sp. Potassium-transporting ATPase C chain 2 (kdpC2) and what are its key characteristics?

    Recombinant Nostoc sp. Potassium-transporting ATPase C chain 2 (kdpC2) is a protein component of the high-affinity potassium uptake system in the cyanobacterium Nostoc sp. It functions as part of the KdpFABC complex, which is essential for potassium homeostasis particularly under low potassium conditions. The recombinant protein is typically expressed in E. coli expression systems for research purposes .

    Key Characteristics:

    PropertyInformation
    UniProt AccessionQ8YPF1
    Protein Length199 amino acids (full length)
    Molecular FunctionComponent of potassium transport system
    Ordered Locus Nameall4243
    Recommended Storage-20°C to -80°C
    Working Storage4°C for up to one week
    Buffer CompositionTris-based buffer with 50% glycerol

    The protein is typically provided as a recombinant product with a His-tag or other affinity tags to facilitate purification and downstream applications .

  • How does kdpC2 function within the KdpFABC complex?

    The kdpC2 protein functions as a catalytic chaperone within the KdpFABC complex, playing a crucial role in the nucleotide-binding mechanism. Unlike typical P-type ATPases, the KdpFABC complex represents a unique chimera of ion pumps and ion channels, with kdpC2 contributing to this specialized mechanism .

    Specifically, kdpC2 interacts with the nucleotide-binding loop of KdpB in an ATP-dependent manner, forming a transient KdpB/KdpC/ATP ternary complex. This interaction increases ATP-binding affinity, thereby enhancing the efficiency of the ATP hydrolysis required for potassium transport . This mechanism shares parallels with ABC transporters rather than traditional P-type ATPases, as the ATP nucleotide is coordinated via double hydrogen bonds at a conserved glutamine residue present in KdpC .

  • What are the recommended storage and handling conditions for recombinant kdpC2?

    For optimal stability and activity of recombinant kdpC2, researchers should follow these storage and handling guidelines:

    Storage Conditions:

    • Store at -20°C to -80°C for long-term storage

    • For working aliquots, store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles, as this can significantly degrade protein quality

    Buffer Composition:

    • Typically supplied in a Tris-based buffer with 50% glycerol

    • pH is optimized for protein stability (usually around pH 8.0)

    Handling Recommendations:

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

    • When diluting stock solution, maintain protein concentration within recommended ranges

    • For extended experiments, prepare small working aliquots to avoid repeated freezing and thawing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.