Recombinant Nostoc sp. Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we will accommodate specific format requests. Please indicate your preferred format in the order notes.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize the development of the specified tag.
Synonyms
lgt; all4699; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
lgt
Target Protein Sequence
MALPLAFLFTSPGPVLVEIGPITIRWYGLLIATAVLIGVSLSQYLAKRRQVNPDLLSDLS IWLVIGAIPAARIYYVLFQWSEYAQHPERIIAIWQGGIAIHGAIIGGTLAALIFAKLKRV PFWQLADLVAPSLILGQAIGRWGNFFNSEAFGRPTNLPWKLYIPIERRPPDLVSFEYFHP TFLYESIWDLMVFALLITLFFRSLAGKPRLKVGTLFMVYLATYSLGRLWIEGLRTDSLML GPLRIAQVVSLTGIALGLAGLAWLYVRKRPLPDVVPSAKDTGE
Uniprot No.

Target Background

Function
Recombinant Nostoc sp. Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the first step in the formation of mature lipoproteins.
Database Links

KEGG: ana:all4699

STRING: 103690.all4699

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what role does it play in Nostoc species?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme that catalyzes the first step in bacterial lipoprotein biogenesis. In Nostoc and other cyanobacteria, as in Gram-negative bacteria, Lgt mediates the attachment of a diacylglyceryl moiety from phosphatidylglycerol to the cysteine residue in the conserved lipobox sequence of preprolipoproteins. This modification is essential for proper lipoprotein anchoring in bacterial membranes. Lipoproteins in cyanobacteria such as Nostoc play crucial roles in photosynthesis, nitrogen fixation, and stress responses, making Lgt an important enzyme for cyanobacterial physiology and metabolism. The fundamental process occurs after preprolipoproteins are secreted through the inner membrane via Sec or Tat pathways, where Lgt then performs its catalytic function .

How does the structure of Nostoc sp. Lgt compare with Lgt from other bacterial species?

While specific structural data for Nostoc sp. Lgt is limited in the current literature, comparative genomic analyses suggest conservation of key catalytic domains across cyanobacterial and other bacterial species. Lgt enzymes typically contain multiple transmembrane domains that anchor them in the cytoplasmic membrane, with catalytic regions exposed to the periplasmic space. Research on E. coli Lgt has demonstrated that it functions as an integral membrane protein with seven to eight predicted transmembrane regions. Like other bacterial Lgt proteins, Nostoc sp. Lgt likely contains conserved catalytic residues necessary for the transfer of the diacylglyceryl group to the target cysteine. Sequence alignment analysis would reveal specific conservation patterns and potential structural variations that might influence substrate specificity or catalytic efficiency in Nostoc compared to pathogenic bacteria like E. coli .

What are the optimal expression systems for producing recombinant Nostoc sp. Lgt?

  • Vector selection: pET-based vectors with T7 promoter systems offer tight control and high expression levels when induced with IPTG.

  • Fusion tags: N-terminal His6-tags facilitate purification while MBP or SUMO tags can enhance solubility.

  • Growth conditions: Lower growth temperatures (16-20°C) after induction frequently yield better folding of membrane proteins.

  • Membrane fraction recovery: Protocols using specialized detergents like n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are essential for extraction.

How can researchers troubleshoot low yield or inactivity of recombinant Nostoc sp. Lgt?

When facing challenges with recombinant Nostoc sp. Lgt expression, researchers should implement a systematic troubleshooting approach:

ProblemPotential CauseMethodological Solution
Poor expression levelCodon biasOptimize codons for expression host or use Rosetta strains
Inclusion body formationRapid overexpressionReduce induction temperature to 16°C; use auto-induction media
Low activity after purificationDetergent-induced denaturationScreen multiple detergents (DDM, CHAPS, LMNG) at varying concentrations
Protein aggregationImproper foldingInclude glycerol (10-15%) and specific phospholipids in buffer systems
Proteolytic degradationHost proteasesAdd protease inhibitor cocktails; use protease-deficient strains

Additionally, activity rescue may be attempted through phospholipid reconstitution systems, particularly with phosphatidylglycerol, which serves as the natural substrate donor for Lgt enzymatic activity .

What biochemical assays are most suitable for evaluating recombinant Nostoc sp. Lgt activity?

The enzymatic activity of recombinant Nostoc sp. Lgt can be assessed through several complementary approaches:

  • Radiolabeled substrate assay: Using [³H]- or [¹⁴C]-labeled phosphatidylglycerol to monitor the transfer of diacylglyceryl moiety to synthetic peptide substrates containing the lipobox motif.

  • FRET-based assays: Utilizing fluorescently labeled substrate peptides that exhibit altered FRET signals upon diacylglyceryl transfer.

  • Mass spectrometry-based assays: Detecting the mass shift associated with diacylglyceryl attachment to substrate peptides, providing precise quantification of enzymatic activity.

  • Complementation assays: Evaluating the ability of Nostoc sp. Lgt to rescue growth defects in conditional lgt mutants of model organisms like E. coli.

Kinetic parameters (Km, Vmax, kcat) should be determined using varying concentrations of both phospholipid donor and peptide acceptor substrates. These assays must be conducted in optimized detergent micelles or proteoliposomes to maintain enzyme functionality in an environment mimicking the native membrane context .

How do researchers confirm proper folding and stability of recombinant Nostoc sp. Lgt?

Assessment of proper folding and stability for membrane proteins like Nostoc sp. Lgt requires specialized approaches:

  • Circular dichroism (CD) spectroscopy: Provides secondary structure information, particularly useful for comparing wild-type and mutant variants.

  • Thermal shift assays: Modified for membrane proteins using fluorescent dyes like CPM (7-Diethylamino-3-(4'-maleimidylphenyl)-4-methylcoumarin) that bind to exposed cysteine residues upon thermal denaturation.

  • Limited proteolysis: Properly folded proteins show distinctive, reproducible proteolytic patterns when subjected to limited protease digestion.

  • Size-exclusion chromatography: Coupled with multi-angle light scattering (SEC-MALS) to assess monodispersity and oligomeric state in detergent micelles.

  • Differential scanning calorimetry: To determine thermal unfolding transitions and stability in various buffer and detergent conditions.

The choice of detergent is particularly crucial for maintaining stability, with mild detergents like DDM often providing the best balance between extraction efficiency and preservation of native structure.

What methodologies are effective for screening potential inhibitors of Nostoc sp. Lgt?

Development of inhibitors targeting Nostoc sp. Lgt can employ multiple screening approaches:

  • In vitro biochemical screening: High-throughput assays using purified recombinant Lgt and fluorescently labeled substrates can screen compound libraries for inhibitory activity. Compounds showing significant inhibition (>50% at 10 μM) would advance to secondary assays.

  • Structure-based virtual screening: If structural data becomes available through crystallography or homology modeling, computational docking of virtual compound libraries can identify potential binding modes and interaction patterns with the enzyme's active site.

  • Fragment-based screening: Using biophysical methods like differential scanning fluorimetry (DSF), surface plasmon resonance (SPR), or NMR to identify low molecular weight fragments that bind to Lgt, which can then be optimized into lead compounds.

Recent research has identified the first Lgt inhibitors with bactericidal activity against wild-type Acinetobacter baumannii and E. coli strains, demonstrating the druggability of this enzyme class. These compounds potently inhibit Lgt biochemical activity in vitro and could serve as starting points for developing Nostoc sp. Lgt inhibitors .

How can researchers distinguish between specific Lgt inhibition and general membrane disruption effects?

Differentiating specific Lgt inhibition from general membrane effects requires multiple control experiments:

  • Counter-screening against membrane integrity: Using fluorescent dyes (SYTOX Green, propidium iodide) to assess whether compounds directly permeabilize bacterial membranes.

  • Activity against purified enzyme: Demonstrating direct inhibition of purified recombinant Lgt in biochemical assays at concentrations correlating with cellular effects.

  • Resistance development analysis: Compounds acting through specific Lgt inhibition would likely generate resistance mutations in the lgt gene, whereas membrane disruptors typically show different resistance mechanisms.

  • Comparative analysis with known membrane disruptors: Testing candidate compounds alongside established membrane-active agents to compare phenotypic effects.

  • Transcriptomic profiling: Compounds specifically targeting Lgt should produce gene expression signatures distinct from those caused by general membrane perturbation.

Research has shown that Lgt inhibition leads to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics, but these effects occur through a specific mechanism different from direct membrane disruption .

How does Nostoc sp. Lgt function compare to Lgt in pathogenic bacteria like E. coli?

While sharing the core catalytic function of transferring a diacylglyceryl moiety to preprolipoproteins, Nostoc sp. Lgt and pathogenic bacterial Lgt enzymes exhibit important differences and similarities:

FeatureNostoc sp. LgtPathogenic Bacteria Lgt (e.g., E. coli)Implications for Research
Substrate specificityMay be adapted to cyanobacterial lipobox variantsRecognizes classical lipobox sequences [LVI][ASTVI][GAS]CMay require modified synthetic substrates for activity assays
Membrane environmentThylakoid and cytoplasmic membranesInner membrane onlyReconstitution systems may require different lipid compositions
Physiological importanceSupports photosynthesis and nitrogen fixationEssential for cell envelope integrityDifferent phenotypic readouts for functional studies
Inhibitor sensitivityPotentially unique binding pocket characteristicsValidated as antibacterial targetMay allow development of selective inhibitors

In E. coli, Lgt depletion leads to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics. Studies have shown that, unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . Comparative studies between Nostoc sp. Lgt and pathogenic bacterial Lgt could reveal evolutionary adaptations and potential selective targeting strategies.

What unique features of cyanobacterial lipoproteins might influence Nostoc sp. Lgt function?

Cyanobacteria like Nostoc species possess several distinct features in their lipoprotein systems that could influence Lgt function:

  • Dual membrane systems: Unlike most bacteria, cyanobacteria have both cytoplasmic and thylakoid membrane systems, potentially requiring specialized sorting mechanisms for lipoproteins.

  • Photosynthetic apparatus requirements: Many cyanobacterial lipoproteins are associated with photosynthetic complexes, suggesting potential co-evolution of Lgt with photosystem components.

  • Nitrogen fixation apparatus: In Nostoc species capable of nitrogen fixation, specialized lipoproteins may be required for heterocyst formation and nitrogenase protection from oxygen.

  • Environmental adaptations: As extremophiles capable of surviving desiccation and nutrient limitation, Nostoc species may have evolved lipoproteins with specialized functions requiring adapted Lgt activity.

Methodologically, researchers investigating these unique features should employ comparative genomics to identify cyanobacteria-specific lipoprotein sequences, and conduct heterologous expression studies to determine if Nostoc sp. Lgt can process typical bacterial lipoprotein precursors and vice versa.

How can researchers study the impact of Lgt inhibition on Nostoc sp. physiology?

Investigating the physiological consequences of Lgt inhibition in Nostoc species requires strategic approaches:

  • Genetic systems: Development of conditional knockout or depletion strains using inducible promoters to control lgt expression levels. Alternatively, CRISPR-Cas9 based systems can be adapted for cyanobacterial genome editing.

  • Chemical genetic approach: Application of identified Lgt inhibitors at sub-lethal concentrations, followed by comprehensive phenotypic characterization.

  • Multi-omics analysis: Integration of:

    • Proteomics to identify mislocalized lipoproteins

    • Transcriptomics to capture regulatory responses

    • Metabolomics to detect alterations in metabolic pathways

    • Lipidomics to assess membrane composition changes

  • Physiological measurements:

    • Photosynthetic efficiency (oxygen evolution, chlorophyll fluorescence)

    • Nitrogen fixation rates (acetylene reduction assay)

    • Membrane integrity (fluorescent dye permeability)

    • Stress resistance (desiccation, UV, oxidative stress challenges)

These methodologies would provide a comprehensive understanding of how Lgt function integrates with the unique physiology of Nostoc species, particularly in relation to photosynthesis and nitrogen fixation processes.

What controls should be included when evaluating Nostoc sp. Lgt mutants?

Robust experimental design for studying Nostoc sp. Lgt mutants requires appropriate controls:

  • Complementation controls: Reintroduction of wild-type lgt gene to confirm phenotype reversibility and rule out polar effects or secondary mutations.

  • Domain-specific mutants: Generation of catalytic site mutants (rather than complete gene deletion) to distinguish between enzymatic and structural roles.

  • Other lipoprotein processing pathway controls: Parallel analysis of LspA (signal peptidase II) and Lnt (apolipoprotein N-acyltransferase) mutants to differentiate Lgt-specific effects from general lipoprotein processing defects.

  • Growth condition controls: Assessment under varying light intensities, nitrogen sources, and stress conditions to capture condition-specific phenotypes.

  • Temporal controls: Time-course experiments following Lgt depletion to distinguish primary from secondary effects.

  • Species comparative controls: Parallel experiments in model cyanobacteria (Synechocystis sp. PCC 6803) to identify Nostoc-specific versus general cyanobacterial responses.

These controls ensure that observed phenotypes can be confidently attributed to Lgt function rather than experimental artifacts or secondary effects.

What strategies can overcome challenges in structural determination of Nostoc sp. Lgt?

Membrane proteins like Lgt present significant challenges for structural biology, requiring specialized approaches:

  • Protein engineering strategies:

    • Truncation of flexible regions to improve crystallization propensity

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Thermostabilizing mutations identified through alanine scanning

    • Antibody fragment (Fab/nanobody) co-crystallization to provide crystal contacts

  • Advanced crystallography methods:

    • Lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

    • Microcrystal electron diffraction (MicroED) for small crystals

    • Serial femtosecond crystallography at X-ray free-electron lasers (XFELs)

  • Cryo-electron microscopy:

    • Single-particle analysis for larger constructs or complexes

    • Subtomogram averaging for in situ structural determination

  • Integrative structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions

    • Cross-linking mass spectrometry (XL-MS) to establish distance constraints

    • Solid-state NMR for specific structural questions

Each method has specific sample preparation requirements, and often a combination of approaches provides the most complete structural insights.

How can computational approaches complement experimental studies of Nostoc sp. Lgt?

Computational methods provide valuable insights that complement experimental work on Nostoc sp. Lgt:

  • Homology modeling: Using established bacterial Lgt structures as templates to predict Nostoc sp. Lgt structure, with particular attention to the catalytic site architecture.

  • Molecular dynamics simulations: Investigating:

    • Protein-membrane interactions in various lipid compositions

    • Substrate binding and product release pathways

    • Conformational changes during the catalytic cycle

    • Effects of potential mutations on protein stability and function

  • Sequence-based predictions:

    • Evolutionary coupling analysis to identify co-evolved residue pairs

    • Conservation mapping to highlight functionally important regions

    • Transmembrane topology prediction to guide construct design

  • Systems biology integration:

    • Protein-protein interaction network prediction

    • Functional associations based on gene neighborhood and co-expression data

    • Pathway modeling to understand physiological consequences of Lgt inhibition

These computational approaches are particularly valuable when structural data is limited, providing testable hypotheses and guiding experimental design.

How does research on Nostoc sp. Lgt inform development of antibacterial agents targeting pathogenic bacteria?

Research on Nostoc sp. Lgt provides valuable insights for antibacterial development through comparative approaches:

  • Evolutionary conservation analysis: Identifying highly conserved regions across bacterial species that represent potential broad-spectrum targets, versus variable regions that could enable selective targeting.

  • Structural basis for selectivity: Elucidating unique structural features of Lgt from different species can guide the design of selective inhibitors that target pathogenic bacteria while sparing beneficial microbiota.

  • Resistance mechanism understanding: Investigating potential resistance mechanisms in the non-pathogenic Nostoc system provides safer models for anticipating resistance in clinical settings.

  • Natural product discovery: As Nostoc species produce diverse bioactive compounds, they might harbor natural Lgt inhibitors that could serve as starting points for drug development.

Recent research has identified the first Lgt inhibitors that potently inhibit biochemical activity in vitro and are bactericidal against wild-type Acinetobacter baumannii and E. coli strains. Unlike inhibitors targeting other steps in lipoprotein biosynthesis, resistance to Lgt inhibitors appears not to be conferred by deletion of the major outer membrane lipoprotein (lpp), suggesting a potential advantage for therapeutic development .

What considerations are important when translating findings from Nostoc sp. Lgt to clinical applications?

Translating research findings from Nostoc sp. Lgt studies to clinical applications requires addressing several key considerations:

  • Target validation differences: While Lgt is essential in many pathogenic bacteria, differences in essentiality across bacterial species must be thoroughly characterized.

  • Pharmacokinetic/pharmacodynamic (PK/PD) requirements: Inhibitors must reach effective concentrations at infection sites, considering penetration into bacterial biofilms and host tissues.

  • Selectivity profiling: Comprehensive testing against:

    • Panel of pathogenic bacteria

    • Human cell lines to assess cytotoxicity

    • Gut microbiome representatives to evaluate ecological impact

  • Resistance development assessment: Serial passage experiments to determine:

    • Frequency of resistance emergence

    • Mechanisms of resistance

    • Fitness costs of resistance mutations

  • Combination potential: Evaluation of synergistic interactions with existing antibiotics, particularly those affected by membrane permeability.

These considerations ensure that fundamental insights gained from studying Nostoc sp. Lgt translate effectively into clinically relevant applications with minimized risks and maximized therapeutic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.